Gene Information

Name : Acid_5032 (Acid_5032)
Accession : YP_826272.1
Strain : Candidatus Solibacter usitatus Ellin6076
Genome accession: NC_008536
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6353269 - 6353943 bp
Length : 675 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: fra:Francci3_0978 two component transcriptional regulator, winged helix family

DNA sequence : 
GTGCCTCGCATCCTCGTCGTCGAAGACGATCAGCGGACCGCCGAGTCCATCAAGCTCTACCTCGAACACGACGGCTTCGA
AGCACGCCTCGCCGCCGACGGCCTCTCCGCCCTGGAACTTTGCCGCACCACCGCGCCCGACCTTGTCATCCTGGACCGCA
TGCTCCCCCTCGTCGATGGCGCCGAAATCTGCCGTCGCTTGCGCGCCGCCGGCAACATCCCCATCATCATGCTCACCGCC
CGCACCACCGAAGCCGACAAGCTTGAGGGACTGCGCCTCGGCGCCGACGACTACGTCACCAAGCCCTTCAGCCCCCGCGA
ACTCGTGGCGCGCGTCCACGCCGTCCTGCGCCGCGCCGCCCCCGCGCCCGCTCCGCGCTTCGCCGCGATTGCAATCGATT
TCGAACGCGGAACGCTCCACCGTCACGGCGAACCCATTGCGCTCACCACCACCGAATTCAAGCTGCTCGAAACCCTCTGC
CGCGCGCCCGGCCGTATCTTTTCCCGCTCGGAACTCCTGGAGCGCATCTTCGGCTGGGACTACGAAGGCACGGAGCGCAC
CGTGGACGTCCACATCGCCAACCTGCGCCGCAAAATTGACGACAATCCCGCGCAGCCCGCGCTCATCGCCACGATCTTCG
GCGCCGGCTACAAATGGATCGGCGGACCCTCGTGA

Protein sequence : 
MPRILVVEDDQRTAESIKLYLEHDGFEARLAADGLSALELCRTTAPDLVILDRMLPLVDGAEICRRLRAAGNIPIIMLTA
RTTEADKLEGLRLGADDYVTKPFSPRELVARVHAVLRRAAPAPAPRFAAIAIDFERGTLHRHGEPIALTTTEFKLLETLC
RAPGRIFSRSELLERIFGWDYEGTERTVDVHIANLRRKIDDNPAQPALIATIFGAGYKWIGGPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-16 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acid_5032 YP_826272.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-27 44
Acid_5032 YP_826272.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-30 44
Acid_5032 YP_826272.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-28 43
Acid_5032 YP_826272.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-28 43
Acid_5032 YP_826272.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-28 43
Acid_5032 YP_826272.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-28 43
Acid_5032 YP_826272.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-28 43
Acid_5032 YP_826272.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-28 43
Acid_5032 YP_826272.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-28 43
Acid_5032 YP_826272.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-28 43
Acid_5032 YP_826272.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-28 43
Acid_5032 YP_826272.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-28 43
Acid_5032 YP_826272.1 two component transcriptional regulator BAC0308 Protein 4e-18 42
Acid_5032 YP_826272.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-24 42
Acid_5032 YP_826272.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 2e-23 42
Acid_5032 YP_826272.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-24 42
Acid_5032 YP_826272.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-25 41
Acid_5032 YP_826272.1 two component transcriptional regulator CP004022.1.gene1676. Protein 7e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acid_5032 YP_826272.1 two component transcriptional regulator VFG1390 Protein 6e-23 41
Acid_5032 YP_826272.1 two component transcriptional regulator VFG0596 Protein 5e-17 41