Gene Information

Name : Acid_2164 (Acid_2164)
Accession : YP_823439.1
Strain : Candidatus Solibacter usitatus Ellin6076
Genome accession: NC_008536
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2769549 - 2770265 bp
Length : 717 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bxe:Bxe_B1389 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
ATGCGAATTCTCGTGGTCGAGGACGAAAAACGAATTGCCGATTTTCTATGCCGCGGCTTGGAAGGCGCTGGCTACGCGGT
AGACGCCGCCCTCACCGGCGGCGCCGCGCTCGACCTGATTCACGACACCGACTACGACCTCGTCGTGCTGGATCGCATGT
TGCCCGATATGGACGGCCTGCAGGTCCTCGAAAAAATGCGCAGCCGTAAAGCGGGTCCACCCGTCCTGATCCTCAGCGCG
CGCGGCGCGCTTGACGATCGCGTCAAGGGACTCGAGCAGGGCGCCGACGATTACCTGGTCAAACCCTTCGCGTTCGTCGA
ACTCCTGGCGCGTGTGCGCGCCCTGTTGCGTCGCGGACAGCCCACGCCGGAGCGCCTCCAGGTCTCCGACCTCGCGCTCG
ATTGCATTCGCCGCAAGGTGACGCGCGGCGCCGAGACCATCGACCTGGCCCCCAAGGAATTCGGCATCCTGGAATATATG
ATGCGCAACAAGGGCCGCCCCTTGAGCCGTACCATGATCGTGGAGCATGTGTGGGACATGGACTACGACGGCCTCACCAA
TATCGTGGATGTCTACATCCGCCACCTGCGCAGCAAGATCGACGACCGCTTCCAACAGAAGCTGATTCAAACCGTGCGCG
GCATCGGATACATGATCGAAGCGCCCGACAAACCAGCCGACCGCTCTACCGAGCCGGCTGCCCTCCCGCAGGTCTGA

Protein sequence :
MRILVVEDEKRIADFLCRGLEGAGYAVDAALTGGAALDLIHDTDYDLVVLDRMLPDMDGLQVLEKMRSRKAGPPVLILSA
RGALDDRVKGLEQGADDYLVKPFAFVELLARVRALLRRGQPTPERLQVSDLALDCIRRKVTRGAETIDLAPKEFGILEYM
MRNKGRPLSRTMIVEHVWDMDYDGLTNIVDVYIRHLRSKIDDRFQQKLIQTVRGIGYMIEAPDKPADRSTEPAALPQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-38 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-37 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator BAC0083 Protein 1e-45 52
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator BAC0111 Protein 7e-50 52
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator BAC0125 Protein 2e-46 52
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator BAC0197 Protein 5e-46 51
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator BAC0347 Protein 4e-43 50
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator BAC0638 Protein 7e-42 49
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator BAC0308 Protein 3e-41 46
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 2e-28 43
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 2e-28 43
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator BAC0487 Protein 8e-24 42
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 2e-28 42
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 3e-28 42
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 3e-28 42
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 3e-28 42
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 3e-28 42
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 3e-28 42
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 3e-28 42
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 2e-28 42
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 3e-28 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator VFG0596 Protein 7e-39 46
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator VFG1390 Protein 7e-33 45
Acid_2164 YP_823439.1 two component heavy metal response transcriptional regulator VFG0473 Protein 2e-29 42