Gene Information

Name : rpmF (LBUL_0751)
Accession : YP_812803.1
Strain : Lactobacillus delbrueckii ATCC BAA-365
Genome accession: NC_008529
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L32
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG0333
EC number : -
Position : 709184 - 709375 bp
Length : 192 bp
Strand : +
Note : some L32 proteins have zinc finger motifs consisting of CXXC while others do not

DNA sequence :
ATGGCAGTTCCTGCAAGACATACTTCTAAGCAAAAGAAACGTTCACGTCGCGCTCACTTGAAGCTCAGCGTGCCAGCAAT
GCACTACGACGCAACTACTGGTGAATACCGTTTGAGCCACCGTGTTTCCCCTAAGGGTTACTACAAGGGTCGTCAAGTAG
TCAGCGAAAACAGCGCTAGCGATAACGACTAG

Protein sequence :
MAVPARHTSKQKKRSRRAHLKLSVPAMHYDATTGEYRLSHRVSPKGYYKGRQVVSENSASDND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmF NP_814315.1 50S ribosomal protein L32 Not tested Not named Protein 3e-10 57
ef0071 AAM75276.1 EF0071 Not tested Not named Protein 2e-10 57
rpmF NP_814351.1 50S ribosomal protein L32 Not tested Not named Protein 4e-10 54
ef0104 AAM75307.1 EF0104 Not tested Not named Protein 2e-10 54