|
Name : rpmJ (LBUL_0373) Accession : YP_812468.1 Strain : Lactobacillus delbrueckii ATCC BAA-365 Genome accession: NC_008529 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0257 EC number : - Position : 352424 - 352540 bp Length : 117 bp Strand : + Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io DNA sequence : ATGAAGGTTAGACCATCTGTTAAGCCAATGTGCGAACATTGCAAGGTCATTAAGAGACATGGTCGTGTTATGGTTATTTG CCCTGCAAATCCAAAGCACAAGCAACGTCAAGGTTAA Protein sequence : MKVRPSVKPMCEHCKVIKRHGRVMVICPANPKHKQRQG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 0.060 | 43 |
