Gene Information

Name : pmrA (PA14_63150)
Accession : YP_793240.1
Strain : Pseudomonas aeruginosa UCBPP-PA14
Genome accession: NC_008463
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5635995 - 5636660 bp
Length : 666 bp
Strand : +
Note : -

DNA sequence :
ATGAGAATACTGCTGGCCGAGGACGACCTGCTGCTCGGCGACGGCATCCGCGCCGGGCTGCGCCTGGAAGGCGATACCGT
GGAATGGGTGACCGACGGCGTGGCCGCGGAGAACGCGCTGGTCACCGACGAGTTCGACCTGCTGGTGCTCGACATCGGCC
TGCCGCGCCGCAGCGGCCTGGACATCCTGCGCAACCTGCGTCACCAGGGCCTGCTCACCCCGGTGCTGCTGCTCACCGCG
CGGGACAAGGTGGCCGACCGGGTCGCCGGGCTCGACAGCGGTGCCGACGACTACCTGACCAAGCCCTTCGATCTCGACGA
ACTGCAGGCACGGGTGCGCGCCCTGACCCGCCGCACCACCGGTCGCGCCCTGCCGCAACTGGTGCACGGCGAGCTGCGCC
TGGACCCGGCGACCCACCAGGTGACCCTGTCCGGCCAGGCGGTGGAACTGGCGCCGCGCGAATACGCGCTGCTGCGCCTG
CTGCTGGAGAACAGCGGCAAGGTGCTCTCGCGCAACCAACTGGAGCAGAGCCTCTACGGCTGGAGCGGCGACGTCGAGAG
CAACGCCATCGAGGTCCATGTCCATCACCTGCGGCGCAAGCTCGGCAACCAGTTGATCCGCACCGTCCGCGGCATCGGCT
ACGGCATCGACCAGCCGGCGCCCTGA

Protein sequence :
MRILLAEDDLLLGDGIRAGLRLEGDTVEWVTDGVAAENALVTDEFDLLVLDIGLPRRSGLDILRNLRHQGLLTPVLLLTA
RDKVADRVAGLDSGADDYLTKPFDLDELQARVRALTRRTTGRALPQLVHGELRLDPATHQVTLSGQAVELAPREYALLRL
LLENSGKVLSRNQLEQSLYGWSGDVESNAIEVHVHHLRRKLGNQLIRTVRGIGYGIDQPAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 8e-30 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pmrA YP_793240.1 two-component response regulator BAC0487 Protein 9e-32 46
pmrA YP_793240.1 two-component response regulator NC_002516.2.879194.p Protein 3e-21 42
pmrA YP_793240.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-24 42
pmrA YP_793240.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-24 42
pmrA YP_793240.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-24 42
pmrA YP_793240.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-24 42
pmrA YP_793240.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-24 42
pmrA YP_793240.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-24 42
pmrA YP_793240.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-24 42
pmrA YP_793240.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-24 42
pmrA YP_793240.1 two-component response regulator BAC0308 Protein 1e-23 41
pmrA YP_793240.1 two-component response regulator BAC0533 Protein 4e-19 41
pmrA YP_793240.1 two-component response regulator CP000647.1.gene4257. Protein 4e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pmrA YP_793240.1 two-component response regulator VFG0473 Protein 2e-34 46
pmrA YP_793240.1 two-component response regulator VFG1390 Protein 2e-29 43