Gene Information

Name : PA14_03290 (PA14_03290)
Accession : YP_788421.1
Strain : Pseudomonas aeruginosa UCBPP-PA14
Genome accession: NC_008463
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 298567 - 298875 bp
Length : 309 bp
Strand : +
Note : -

DNA sequence :
ATGAGCAAGCAACGACGTACGTTTTCCGCCGAGTTCAAACGAGAGGCCGCGGCCCTGGTGTTGGACCAAGGCTACAGCCA
TATCGACGCCTGCCGTTCGCTGGGGGTGGTGGATTCGGCCTTGCGCCGTTGGGTGAAGCAGCTCGAGGCGGAGCGCCAGG
GTGTGACCCCGAAGAGCAAGGCGTTGACGCCTGAGCAGCAAAAGATCCAGGAGCTGGAAGCCCGGATCAACCGGTTGGAG
CGGGAGAAAGCGATATTAAAAAAGGCTACCGCTCTCTTGATGTCGGACGAACTCGATCGTACGCGCTGA

Protein sequence :
MSKQRRTFSAEFKREAAALVLDQGYSHIDACRSLGVVDSALRRWVKQLEAERQGVTPKSKALTPEQQKIQELEARINRLE
REKAILKKATALLMSDELDRTR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 6e-42 100
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 6e-22 58
l7045 CAD33744.1 - Not tested PAI I 536 Protein 8e-23 57
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 8e-23 57
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-21 56
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-22 56
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 9e-22 56
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-22 56
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 9e-22 56
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-22 56
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-22 56
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-22 56
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-22 56
api80 CAF28554.1 putative transposase Not tested YAPI Protein 5e-18 54
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 5e-22 51
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 7e-22 51
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-20 50
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-20 50
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-20 50
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-20 50
ORF SG13 AAN62235.1 conserved hypothetical protein Not tested PAGI-3(SG) Protein 9e-14 43
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 3e-11 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PA14_03290 YP_788421.1 hypothetical protein VFG1553 Protein 2e-22 58
PA14_03290 YP_788421.1 hypothetical protein VFG1485 Protein 3e-23 57
PA14_03290 YP_788421.1 hypothetical protein VFG1123 Protein 3e-22 56
PA14_03290 YP_788421.1 hypothetical protein VFG0784 Protein 6e-21 50
PA14_03290 YP_788421.1 hypothetical protein VFG1566 Protein 1e-11 41