
|
Name : ureB (RPE_3734) Accession : YP_782643.1 Strain : Rhodopseudomonas palustris BisA53 Genome accession: NC_008435 Putative virulence/resistance : Virulence Product : urease subunit beta Function : - COG functional category : E : Amino acid transport and metabolism COG ID : COG0832 EC number : 3.5.1.5 Position : 4175049 - 4175354 bp Length : 306 bp Strand : - Note : ureases catalyze the hydrolysis of urea into ammonia and carbon dioxide; in Helicobacter pylori and Yersinia enterocolitica the ammonia released plays a key role in bacterial survival by neutralizing acids when colonizing the gastric mucosa; the holoenzym DNA sequence : ATGATCCCCGGCGAGTACTTCATCAAGGACGGCGAGATCGAACTCAATGCCGGCCGTGACACGGTGACGCTCAGCGTCGC CAATAGCGGCGATCGGCCGATCCAGGTCGGCTCGCACTATCATTTCTTCGAGACCAATCCGGCCTTGCAGTTCGACAGAG CTGCGGCGCGCGGGATGCGGCTCGATATCGTGGCCGGCACCGCGGTGCGGTTCGAGCCGGGCCAGACCCGCGAGGTGCAG CTGGTGGCGCTCGCCGGCAAGCGCGAAGTCTACGGTTTTCGCGGCGACGTGATGGGGAAGCTGTAG Protein sequence : MIPGEYFIKDGEIELNAGRDTVTLSVANSGDRPIQVGSHYHFFETNPALQFDRAAARGMRLDIVAGTAVRFEPGQTREVQ LVALAGKREVYGFRGDVMGKL |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ureB | NP_286679.1 | urease subunit beta | Virulence | TAI | Protein | 1e-29 | 73 |
| ureB | NP_287087.1 | urease subunit beta | Not tested | TAI | Protein | 1e-29 | 73 |
| ureB | YP_003784326.1 | urease subunit beta | Not tested | PiCp 7 | Protein | 7e-28 | 63 |
| ureB | YP_005682175.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 4e-28 | 63 |
| ureB | YP_005684267.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 4e-28 | 63 |
| ureB | YP_005686359.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 4e-28 | 63 |