Gene Information

Name : RPE_3658 (RPE_3658)
Accession : YP_782568.1
Strain : Rhodopseudomonas palustris BisA53
Genome accession: NC_008435
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 4090181 - 4090606 bp
Length : 426 bp
Strand : -
Note : TIGRFAM: arsenate reductase; PFAM: arsenate reductase and related; KEGG: rpd:RPD_3418 arsenate reductase

DNA sequence : 
ATGGACGTCGTCATCTACCACAATCCCGGCTGCGGCACCTCGCGCAATACGCTCGGCCTGATCCGCAATGCCGGCATCGA
GCCGCATGTGATCGAGTATCTGAAATCCCCGCCGAGCCGCGCGCTGCTTCAACAACTGATCGCGCGCGCCGGGCTGACGC
CGCGCCAACTGCTGCGCCAGAAGGGCACGCCGTATCAGGCGCTGATGCTGGATGATCCGGCGCTGACCGATGATGATCTG
CTCGGACATATGATGGCTGATCCGATCCTGATCGAGCGTCCGCTTGTCATCTCGCCGAAGGGTGTGCGGCTGTGCCGCCC
CTCCGAGACCGTGCTCGATCTGCTGCCGCCGCAGCAAGGCGAATTCCGCAAAGAGGACGGCGAACTGGTCATCGACGCCG
CCGGCCGCCCCGTCGCAACCGTCTGA

Protein sequence : 
MDVVIYHNPGCGTSRNTLGLIRNAGIEPHVIEYLKSPPSRALLQQLIARAGLTPRQLLRQKGTPYQALMLDDPALTDDDL
LGHMMADPILIERPLVISPKGVRLCRPSETVLDLLPPQQGEFRKEDGELVIDAAGRPVATV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 4e-29 60
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 4e-29 60
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 3e-29 60
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 5e-29 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPE_3658 YP_782568.1 arsenate reductase BAC0584 Protein 3e-31 58
RPE_3658 YP_782568.1 arsenate reductase BAC0583 Protein 1e-30 56
RPE_3658 YP_782568.1 arsenate reductase BAC0585 Protein 2e-31 56
RPE_3658 YP_782568.1 arsenate reductase BAC0582 Protein 2e-30 56