Gene Information

Name : RPE_1928 (RPE_1928)
Accession : YP_780852.1
Strain : Rhodopseudomonas palustris BisA53
Genome accession: NC_008435
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2138906 - 2139601 bp
Length : 696 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rpc:RPC_1830 two component transcriptional regulator, winged helix family

DNA sequence :
TTGCGTCTGCTAGTCGTCGAAGATGATCCCGACCTCAATCGTCAGCTCGCCTCGGCGCTGACCGACGCCGGCTATGTGGT
CGATCGCGCCTTCGACGGCGAGGAGGGGCACTTCCTCGGCGACACCGAGCCCTATGACGCGGTGGTGCTCGATATCGGCC
TGCCGAAGATGGACGGCATCGCGGTGCTGGAAGCCTGGCGGCGCAACGCCCGCGCCATGCCGGTGTTGATCCTCACCGCG
CGCGATCGCTGGAGCGACAAGGTGCAGGGCTTCGACGCCGGCGCCGACGACTATGTGTCAAAACCGTTTCATCTGGAGGA
AGTGCTGGCGCGGATTCGCGCGCTGCTGCGCCGCACCGCGGGCCACGCCCAGTCGGAACTGAGCTGCGGCCCGGTGGTGC
TGGACACCCGCACCGGCCGGGTCAGCGTCAACGGCGCCCCGGTGAAGATGACGTCGCACGAATATCGGCTGCTGGCCTAT
CTGATGCACCACACCGGCCGCGTGGTGTCGCGCACCGAGCTGGTCGAGCATCTCTACGACCAGGACTTTGATCGCGACAG
CAACACCATCGAAGTGTTCGTCGGCCGCATCCGCAGGAAGCTCGACGTCGACATCATCCAGACCGTGCGCGGGCTCGGCT
ATCTCTTGACGCCGCCGACCGCGCCCACGCCCACGCCCCCCGCGTCGTCGGCGTGA

Protein sequence :
MRLLVVEDDPDLNRQLASALTDAGYVVDRAFDGEEGHFLGDTEPYDAVVLDIGLPKMDGIAVLEAWRRNARAMPVLILTA
RDRWSDKVQGFDAGADDYVSKPFHLEEVLARIRALLRRTAGHAQSELSCGPVVLDTRTGRVSVNGAPVKMTSHEYRLLAY
LMHHTGRVVSRTELVEHLYDQDFDRDSNTIEVFVGRIRRKLDVDIIQTVRGLGYLLTPPTAPTPTPPASSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-24 42
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPE_1928 YP_780852.1 two component transcriptional regulator NC_002516.2.879194.p Protein 8e-41 48
RPE_1928 YP_780852.1 two component transcriptional regulator CP000647.1.gene1136. Protein 2e-35 45
RPE_1928 YP_780852.1 two component transcriptional regulator BAC0530 Protein 2e-35 45
RPE_1928 YP_780852.1 two component transcriptional regulator CP001918.1.gene2526. Protein 3e-34 44
RPE_1928 YP_780852.1 two component transcriptional regulator CP000034.1.gene2022. Protein 4e-35 44
RPE_1928 YP_780852.1 two component transcriptional regulator NC_002695.1.913289.p Protein 2e-34 44
RPE_1928 YP_780852.1 two component transcriptional regulator CP001138.1.gene1939. Protein 4e-35 44
RPE_1928 YP_780852.1 two component transcriptional regulator BAC0487 Protein 3e-29 44
RPE_1928 YP_780852.1 two component transcriptional regulator CP004022.1.gene1005. Protein 3e-37 43
RPE_1928 YP_780852.1 two component transcriptional regulator BAC0347 Protein 3e-25 41
RPE_1928 YP_780852.1 two component transcriptional regulator BAC0111 Protein 9e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPE_1928 YP_780852.1 two component transcriptional regulator VFG0475 Protein 3e-35 44
RPE_1928 YP_780852.1 two component transcriptional regulator VFG1390 Protein 2e-26 42
RPE_1928 YP_780852.1 two component transcriptional regulator VFG0596 Protein 6e-25 42
RPE_1928 YP_780852.1 two component transcriptional regulator VFG0473 Protein 1e-26 41