Gene Information

Name : Bamb_5785 (Bamb_5785)
Accession : YP_777666.1
Strain :
Genome accession: NC_008392
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 259213 - 259932 bp
Length : 720 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bur:Bcep18194_C6809 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGACCACCCCAAACGCATCCTCATCGTCGAAGACGACGCCGACATCGCCGACGTGCTGAGCCTGCACCTGCGCGACGA
GCGCTACGAAGTCGTGCACAGCGCGGACGGCACGGAAGGCCTGCGCCTGCTCGAACAGGGCAACTGGGACGCGCTGATCC
TCGACCTGATGCTGCCCGGCGTCGACGGCCTGGAAATCTGCCGGCGCGCCCGCGCGATGGCGCGTTACACGCCGATCATC
ATCACCAGCGCGCGCTCGAGCGAGGTGCACCGGATCCTCGGCCTCGAGCTCGGCGCCGACGACTATCTGGCGAAACCGTT
CTCGGTGCTGGAACTCGTCGCGCGGGTCAAGGCGCTGCTGCGGCGCGTCGACGCGCTCGCGCGCGATTCGCGGATCGACG
CGGGCACGCTCGACGTAGCCGGCCTGTCGATCGACCCGATCGCGCGGGAAGCGAGCGTCGACGGCACGCGCATCGACCTC
ACGCCGCGCGAATTCGACCTGCTGTATTTCTTCGCGCGGCACCCGGGCAAGGTGTTCTCGCGGATGGACCTGCTGAACGC
GGTGTGGGGCTACCAGCACGAAGGCTACGAACACACGGTGAACACCCACATCAACCGGCTGCGCGCGAAGGTCGAGGCCG
ATCCGGCCGAGCCCGTGCGGATCCTCACCGTGTGGGGACGCGGCTACAAGCTCGCCGCGCCGGACCAGCGGGACGCCTGA

Protein sequence :
MDHPKRILIVEDDADIADVLSLHLRDERYEVVHSADGTEGLRLLEQGNWDALILDLMLPGVDGLEICRRARAMARYTPII
ITSARSSEVHRILGLELGADDYLAKPFSVLELVARVKALLRRVDALARDSRIDAGTLDVAGLSIDPIAREASVDGTRIDL
TPREFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKVEADPAEPVRILTVWGRGYKLAAPDQRDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-72 60
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-71 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bamb_5785 YP_777666.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-38 46
Bamb_5785 YP_777666.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-42 45
Bamb_5785 YP_777666.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-36 43
Bamb_5785 YP_777666.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-36 43
Bamb_5785 YP_777666.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-36 43
Bamb_5785 YP_777666.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-36 43
Bamb_5785 YP_777666.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-36 43
Bamb_5785 YP_777666.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-36 43
Bamb_5785 YP_777666.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-36 43
Bamb_5785 YP_777666.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-36 43
Bamb_5785 YP_777666.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-42 43
Bamb_5785 YP_777666.1 two component transcriptional regulator HE999704.1.gene1528. Protein 4e-34 43
Bamb_5785 YP_777666.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-30 42
Bamb_5785 YP_777666.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-41 42
Bamb_5785 YP_777666.1 two component transcriptional regulator BAC0347 Protein 3e-35 41
Bamb_5785 YP_777666.1 two component transcriptional regulator BAC0111 Protein 7e-37 41
Bamb_5785 YP_777666.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-38 41
Bamb_5785 YP_777666.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-30 41
Bamb_5785 YP_777666.1 two component transcriptional regulator CP001918.1.gene3444. Protein 7e-31 41
Bamb_5785 YP_777666.1 two component transcriptional regulator CP000034.1.gene2186. Protein 1e-31 41
Bamb_5785 YP_777666.1 two component transcriptional regulator BAC0596 Protein 1e-30 41
Bamb_5785 YP_777666.1 two component transcriptional regulator NC_002695.1.916589.p Protein 1e-31 41
Bamb_5785 YP_777666.1 two component transcriptional regulator BAC0039 Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bamb_5785 YP_777666.1 two component transcriptional regulator VFG1563 Protein 5e-72 60
Bamb_5785 YP_777666.1 two component transcriptional regulator VFG1702 Protein 5e-72 60
Bamb_5785 YP_777666.1 two component transcriptional regulator VFG1389 Protein 2e-31 45