Gene Information

Name : Bamb_5186 (Bamb_5186)
Accession : YP_777069.1
Strain :
Genome accession: NC_008391
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2217444 - 2218115 bp
Length : 672 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bur:Bcep18194_B2768 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
ATGCGGATACTGATAGTCGAAGACGAACCCAAGATGGCGTCCTACCTGCGCAAGGGGCTGGCGGAGGCGAGCTATACGGT
CGACGTGGCCGAGAACGGCAAGGACGGGCTGTTCCTCGCGCTGCACGAGGATTTCGATCTCGTCGTGCTCGACGTGATGC
TGCCCGAGCTGGACGGCTTCGAGGTGCTCCGGCGGCTGCGCGCGCAGAAGCAGACGCCGGTCCTGCTGCTGACGGCGCGC
GACGCGATCGAGGACAAGGTCACGGGGCTCGAACTGGGCGCCGACGACTACCTGCTCAAGCCGTTCGCGTATGCGGAGTT
CCTCGCCCGTATCCGTTCACTGCTGCGGCGCGCGCCGCGCAATGCACGCGACCTCCTGCAGGTCGCCGATCTCGAGATCG
ACCTGATCAAGCGCCGGGTACGGCGCGCGGACAACCGCATCGACCTGACCGCGCAGGAATTCGCGCTGCTGCAGCTGCTC
GCGGAACGCGAAGGCGAGGTGCTGACGCGCACCTTCATCACGTCGCAGATCTGGGACATGAATTTCGACAGCGACACGAA
CGTCGTCGATGCGGCGATCAAGCGCCTGCGCGCGAAGATCGACAACGCGTACGAGAAGAAGCTGATCCACACGATCCGCG
GCATGGGCTACGTGCTCGAGGATCGCTCGTGA

Protein sequence :
MRILIVEDEPKMASYLRKGLAEASYTVDVAENGKDGLFLALHEDFDLVVLDVMLPELDGFEVLRRLRAQKQTPVLLLTAR
DAIEDKVTGLELGADDYLLKPFAYAEFLARIRSLLRRAPRNARDLLQVADLEIDLIKRRVRRADNRIDLTAQEFALLQLL
AEREGEVLTRTFITSQIWDMNFDSDTNVVDAAIKRLRAKIDNAYEKKLIHTIRGMGYVLEDRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-51 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-51 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator BAC0197 Protein 1e-57 63
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator BAC0638 Protein 9e-58 61
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator BAC0083 Protein 2e-57 59
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator BAC0125 Protein 5e-58 59
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator BAC0111 Protein 4e-56 58
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator BAC0347 Protein 8e-50 55
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator BAC0308 Protein 1e-52 55
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 1e-34 44
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 1e-34 44
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 1e-34 44
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 1e-34 44
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 1e-34 44
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 1e-34 44
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 1e-34 44
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 1e-34 44
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 7e-32 44
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 2e-29 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator VFG0596 Protein 4e-52 55
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator VFG1390 Protein 1e-35 44
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator VFG1386 Protein 3e-33 43
Bamb_5186 YP_777069.1 two component heavy metal response transcriptional regulator VFG1389 Protein 6e-29 42