Gene Information

Name : Bamb_0912 (Bamb_0912)
Accession : YP_772805.1
Strain :
Genome accession: NC_008390
Putative virulence/resistance : Unknown
Product : phage integrase family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 1002058 - 1003299 bp
Length : 1242 bp
Strand : -
Note : PFAM: phage integrase family protein; KEGG: pca:Pcar_1823 putative integrase prophage protein

DNA sequence :
ATGCCGCTTACCGACACGACCATCCGCAATACGAAGCCTGTCGAAAAGCCCATCAAGCTATTCGACGGCGGCGGCCTTTT
TCTGCTCGTCACGCCGGCCGGGCAGCGCTACTGGCGGCTCAAGTACCGCGCCGCCGGCAAAGAGAAGTTGCTGGCGCTTG
GCGTCTACCCCGAGGTTACGCTCGCAACTGCGCGCCGGAAGCGAGATGAGGCTCGGGAAAGGCTGGCTGCTGGCATCGAT
CCGGGTGAGGCGAAGAAGGCAGAGAAGCGGACAGTCCGCCTGAACGCGGAAAACTCGTTCGAGGCAGTGGCGCGCGAATG
GCACGCCAAGTACGCTCCCACTTGGTCGGAAAACCACGCCGGCCGTATCCTGCGCCGCCTAGAGGTCGACGCTTTCCCAT
GGATCAGCGGCAAGCCCATCGCAGACCTCGCGCCGCCAGATGTGCTTGATGCGCTGCGCCGAGTTGAAAAGCGCGGCGCG
CTCGAGACTGCCCATCGCCTCCATGCCAACATCAGCCAGGTGTGCCGGTATGCCGTGGCGACCGGACGCGCGCAGCGTGA
CGTAACTGCCGACCTCCGCGGCGCGCTGCCGCCGGTTCAGCAGGAGCATATGGCAGCGCTCACTGATCCGAAGCAGGTCG
CCGAGCTGCTGCGCGCGATCGACGGCTATCAAGGCACCTTCCCGGTAATGTGCGCTCTCCGCCTCGCCCCGCTACTCTTT
CAGCGGCCCGGTGAACTGCGCGCCGCCGAGTGGGCCGAGCTCGATCTCGACGCCGGCACCTGGGAGATTCCAAGCGACCG
AATGAAGCGGACCAAACAGGGCAAGGCGTCTGGAGGCGCCCACATCGTGCCACTCTCGTCTCAAGCAGTCGCGGTTCTGG
GCGAGTTGCACGCGCTAACGGGAAACGGCCGTTTCCTGTTCCCGAGCGTCCGGACAAAAGATCGCCCCATGTCGGACAAC
ACGATCAACGGCGCGCTGCTCCGGCTGGGGTATAACGGCGACACGATGACCGGTCACGGCTTCCGCGCGATGGCCCGCAC
GATCTTGGATGAGGTGCTGGGCCTACCGGCGGCAATCATCGAGGCGCAGCTCGCACACGCCGTGAAAGACCCGCTCGGGC
GCGCGTACAACCGCACCGCCCACCTACCCCAGCGTCGCGAAATGATGCAGCGGTGGGCCGACTACCTTGATGGGCTCAAA
GCAGGAGCGCAGATCATCCCAATTTCAAGGGACACTGCCTGA

Protein sequence :
MPLTDTTIRNTKPVEKPIKLFDGGGLFLLVTPAGQRYWRLKYRAAGKEKLLALGVYPEVTLATARRKRDEARERLAAGID
PGEAKKAEKRTVRLNAENSFEAVAREWHAKYAPTWSENHAGRILRRLEVDAFPWISGKPIADLAPPDVLDALRRVEKRGA
LETAHRLHANISQVCRYAVATGRAQRDVTADLRGALPPVQQEHMAALTDPKQVAELLRAIDGYQGTFPVMCALRLAPLLF
QRPGELRAAEWAELDLDAGTWEIPSDRMKRTKQGKASGGAHIVPLSSQAVAVLGELHALTGNGRFLFPSVRTKDRPMSDN
TINGALLRLGYNGDTMTGHGFRAMARTILDEVLGLPAAIIEAQLAHAVKDPLGRAYNRTAHLPQRREMMQRWADYLDGLK
AGAQIIPISRDTA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 4e-79 46
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 4e-79 46
ESA_03025 YP_001439090.1 hypothetical protein Not tested Not named Protein 3e-72 45
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 9e-78 45
ECs4534 NP_312561.1 integrase Not tested LEE Protein 9e-78 45
int AAC31482.1 CP4-like integrase Not tested LEE Protein 7e-78 45
int ACU09430.1 integrase Not tested LEE Protein 7e-78 45
int AAD44730.1 Int Not tested SHI-2 Protein 4e-77 44
aec33 AAW51716.1 Int Not tested AGI-3 Protein 9e-78 44
int CAC39282.1 integrase Not tested LPA Protein 2e-77 44
unnamed AFX83955.1 integrase Not tested SE-PAI Protein 1e-76 44
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 1e-75 44
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 4e-77 44
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 3e-77 44
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 3e-77 44
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 1e-77 44
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 1e-77 44
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 2e-76 44
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 2e-77 44
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 5e-77 44
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 1e-77 44
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 5e-77 44
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 3e-77 44
int AAL51028.1 CP4-like integrase Not tested LEE Protein 3e-77 44
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 4e-77 44
int-phe AAL60261.1 Int-phe Not tested LEE Protein 3e-77 44
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 2e-76 44
int AAL51003.1 CP4-like integrase Not tested LEE Protein 1e-76 44
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 3e-76 44
int AAK16198.1 Int Not tested PAI-I AL862 Protein 2e-77 44
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 3e-75 43
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 2e-75 43
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 3e-75 43
int AAK00456.1 Int Not tested SHI-1 Protein 4e-70 43
int CAC81896.1 integrase Not tested LEE II Protein 1e-69 43
intB CAD42017.1 bacteriophage P4 integrase Not tested PAI II 536 Protein 6e-67 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bamb_0912 YP_772805.1 phage integrase family protein VFG0783 Protein 4e-78 45
Bamb_0912 YP_772805.1 phage integrase family protein VFG0626 Protein 6e-78 44
Bamb_0912 YP_772805.1 phage integrase family protein VFG1693 Protein 1e-77 44
Bamb_0912 YP_772805.1 phage integrase family protein VFG0598 Protein 1e-75 43
Bamb_0912 YP_772805.1 phage integrase family protein VFG1536 Protein 4e-67 41