Gene Information

Name : Bamb_0657 (Bamb_0657)
Accession : YP_772550.1
Strain :
Genome accession: NC_008390
Putative virulence/resistance : Resistance
Product : major facilitator superfamily transporter
Function : -
COG functional category : G : Carbohydrate transport and metabolism
COG ID : COG2814
EC number : -
Position : 738523 - 739716 bp
Length : 1194 bp
Strand : -
Note : PFAM: major facilitator superfamily MFS_1; KEGG: bur:Bcep18194_A3850 major facilitator superfamily (MFS_1) transporter

DNA sequence : 
TTGAATCCATCCCTGATTGCCATCCTCGCCACGGTATTGCTCGACGCGATCGGCGTCGGGATCGTGATGCCGATCCTCCC
CGGGCTGCTCCGCGCACTCGCGGGGGCCGGCAGCACCGACACCCACTACGGGATCCTCCTCGCGCTCTACGCGTTCGCCC
AGTTCCTGTGCGCGCCGCTGCTCGGCACGCTGAGCGACCGCTTCGGCCGGCGGCCCGTGCTGCTCGCGTCGCTTGCGGGC
GCCGCGCTCGACTACTTGCTGATGGCGCTCGCACCGACGCTGGCGTGGCTTTACGTCGGGCGGCTGATCGCCGGCATCAC
CGGCGCGAACGTCGCGGTCGCAACCGCATACGTGACCGACGTCACGGCCGAACCCGACCGCGCACGGCGCTTCGGCCAGC
TCGGCGCGATGATGGGCGTCGGCTTCATAGCGGGCCCGCTGATCGGCGGGTTGTTCGGCGCGCTGCACCTGCGCGCGCCG
TTCGTCGCGGCAGCGCTCCTCAATGCGCTGAACCTCGCGCTCGTGTGGCGCGCGCTGCCAGAATCGCGTCCGCGCGCAGC
CCGGGAAAGTCGCGGGCTCGCCACGCTCAACCCGTTCGCCGGCATGCGCCGGCTGAGCGGCGCGCCCGCGCTCGGCCCGC
TGATCGGCATCTACGTGATCGTCGCGCTGGTGTCGCAGGCGCCCGCGACGCTGTGGATTCTGTACGGCCAGGAGCATTTC
GGCTGGTCCACGCCGGTCGCCGGGCTGTCGCTCGCCGGCTACGGCGCGTGCCACGCGCTCGCGCAGGCCTTCGCGATCGG
GCCGCTGATCGCACGGCTCGGCGAGCGCCGCGCACTCGCGCTGGGTCTCGCGGGCGACGCGCTCGGGCTGGTGGTGATCG
CGTTCGCGACGGCCGCATGGGTGCCGTTCGCGCTGCTGCCGCTGTTCGCCGCGGGCGGCATGACGCTGCCGGCGTTGCAG
GCGATGCTCGCGCGTCAGGTCGACGATGCCCGACAGGGCGAACTGCAGGGCACGCTCGCGAGCGTGGCGAGCCTGATCGG
CGTCGCCGGGCCGCTTGTTGTCACGACAACCTACGCGGCCACCCGCGGCACGTGGCCGGGGCTCGTATGGGCCGCGGCGG
CGCTGCTCTATCTGCTGGTGCCGCCGTTGCTGGCGGGCGCGCGCCCGACGAGCGCCCCGCGGCCGTCCACGTGA

Protein sequence : 
MNPSLIAILATVLLDAIGVGIVMPILPGLLRALAGAGSTDTHYGILLALYAFAQFLCAPLLGTLSDRFGRRPVLLASLAG
AALDYLLMALAPTLAWLYVGRLIAGITGANVAVATAYVTDVTAEPDRARRFGQLGAMMGVGFIAGPLIGGLFGALHLRAP
FVAAALLNALNLALVWRALPESRPRAARESRGLATLNPFAGMRRLSGAPALGPLIGIYVIVALVSQAPATLWILYGQEHF
GWSTPVAGLSLAGYGACHALAQAFAIGPLIARLGERRALALGLAGDALGLVVIAFATAAWVPFALLPLFAAGGMTLPALQ
AMLARQVDDARQGELQGTLASVASLIGVAGPLVVTTTYAATRGTWPGLVWAAAALLYLLVPPLLAGARPTSAPRPST

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetA(A) ACK44537.1 TetA(A) Not tested SGI1 Protein 2e-62 54
tetA(A) AGK07027.1 TetA(A) Not tested SGI1 Protein 2e-62 54
tetA(A) AGK07085.1 TetA(A) Not tested SGI1 Protein 2e-62 54
tetA YP_006098396.1 tetracycline resistance protein Not tested Tn2411 Protein 2e-62 54
tetA CAJ77066.1 Tetracycline resistance protein Not tested AbaR1 Protein 1e-62 54
tetA(A) ACN81011.1 TetA(A) Not tested AbaR5 Protein 2e-62 54
tetA CAJ77034.1 Tetracycline resistance protein Not tested AbaR1 Protein 8e-59 51
tet(G) AAK02051.1 tetracycline resistance protein Not tested SGI1 Protein 8e-57 51
tetA(G) ABZ01843.1 TetA(G) Not tested SGI2 Protein 8e-57 51
tetA(G) AGK06974.1 TetA(G) Not tested SGI1 Protein 8e-57 51
tetA(G) AGK07104.1 TetA(G) Not tested SGI1 Protein 8e-57 51
tet(H) YP_005176248.1 tetracycline efflux protein, class H Not tested ICEPmu1 Protein 8e-43 43
tetA(B) AAL08445.1 tetracycline resistance protein TetA(B) Not tested SRL Protein 4e-49 42
tetB AEA34667.1 tetracycline resistance determinant Not tested Not named Protein 4e-49 42
tetA(B) AEZ06045.1 tetracycline efflux protein Not tested Tn6167 Protein 6e-49 42
BJAB07104_00277 YP_008207742.1 Permeases of the major facilitator superfamily Not tested AbaR25 Protein 9e-49 42
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily Not tested AbaR26 Protein 9e-49 42
tetA(B) AEQ20905.1 tetracycline resistance protein Not tested Tn6166 Protein 9e-49 42
tetA YP_005797160.1 tetracycline resistance protein, class G (TETA(G)) Not tested AbaR4e Protein 5e-48 42
ABZJ_00260 YP_005524216.1 Tetracycline resistance protein, class B (TETA(B) ) (Metal-tetracycline/H(+) antiporter) Not tested AbaR22 Protein 8e-49 42
tetA(B) AFH57202.1 tetracycline resistance protein Not tested AbaR4a Protein 6e-49 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bamb_0657 YP_772550.1 major facilitator superfamily transporter AY264780.2.gene3.p01 Protein 1e-88 69
Bamb_0657 YP_772550.1 major facilitator superfamily transporter AY743590.gene.p01 Protein 2e-72 56
Bamb_0657 YP_772550.1 major facilitator superfamily transporter Y19114.gene.p01 Protein 3e-71 55
Bamb_0657 YP_772550.1 major facilitator superfamily transporter NC_011586.7045189.p0 Protein 9e-57 54
Bamb_0657 YP_772550.1 major facilitator superfamily transporter AF534183.gene.p01 Protein 7e-63 54
Bamb_0657 YP_772550.1 major facilitator superfamily transporter NC_010410.6002597.p0 Protein 7e-63 54
Bamb_0657 YP_772550.1 major facilitator superfamily transporter CP001485.1.gene2821. Protein 7e-63 54
Bamb_0657 YP_772550.1 major facilitator superfamily transporter X75761.gene.p01 Protein 2e-62 53
Bamb_0657 YP_772550.1 major facilitator superfamily transporter NC_010410.6002612.p0 Protein 5e-59 51
Bamb_0657 YP_772550.1 major facilitator superfamily transporter AF133140.gene.p01 Protein 5e-59 51
Bamb_0657 YP_772550.1 major facilitator superfamily transporter AF133139.gene.p01 Protein 5e-60 51
Bamb_0657 YP_772550.1 major facilitator superfamily transporter AF090987.gene.p01 Protein 6e-57 50
Bamb_0657 YP_772550.1 major facilitator superfamily transporter L06940.gene.p01 Protein 5e-49 46
Bamb_0657 YP_772550.1 major facilitator superfamily transporter Y19116.gene.p01 Protein 1e-47 46
Bamb_0657 YP_772550.1 major facilitator superfamily transporter AF070999.gene.p01 Protein 4e-52 45
Bamb_0657 YP_772550.1 major facilitator superfamily transporter NC_011586.7043399.p0 Protein 3e-47 45
Bamb_0657 YP_772550.1 major facilitator superfamily transporter NC_011595.7059241.p0 Protein 2e-47 45
Bamb_0657 YP_772550.1 major facilitator superfamily transporter NC_010410.6003291.p0 Protein 3e-47 45
Bamb_0657 YP_772550.1 major facilitator superfamily transporter NC_009085.4918440.p0 Protein 7e-45 45
Bamb_0657 YP_772550.1 major facilitator superfamily transporter AJ420072.gene.p01 Protein 3e-44 45
Bamb_0657 YP_772550.1 major facilitator superfamily transporter AF121000.gene.p01 Protein 4e-47 44
Bamb_0657 YP_772550.1 major facilitator superfamily transporter L06798.gene.p01 Protein 7e-45 44
Bamb_0657 YP_772550.1 major facilitator superfamily transporter AF038993.gene.p01 Protein 6e-45 43
Bamb_0657 YP_772550.1 major facilitator superfamily transporter CP004022.1.gene2534. Protein 1e-44 43
Bamb_0657 YP_772550.1 major facilitator superfamily transporter Y15510.gene.p01 Protein 9e-44 43
Bamb_0657 YP_772550.1 major facilitator superfamily transporter AB084246.gene.p01 Protein 4e-49 42
Bamb_0657 YP_772550.1 major facilitator superfamily transporter V00611.gene.p01 Protein 3e-49 42
Bamb_0657 YP_772550.1 major facilitator superfamily transporter NC_010558.1.6275971. Protein 3e-49 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bamb_0657 YP_772550.1 major facilitator superfamily transporter VFG1036 Protein 3e-49 42