Gene Information

Name : Bamb_2665 (Bamb_2665)
Accession : YP_774555.1
Strain :
Genome accession: NC_008390
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2935435 - 2936097 bp
Length : 663 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bur:Bcep18194_A5949 two component transcriptional regulator, winged helix family

DNA sequence : 
ATGCGGATTCTCCTCGTTGAAGACGATCGAATGATTGCCGAAGGCGTACGCAAGGCCTTGCGCGCCGACGGCTTCGCGGT
CGACTGGGTGCAGGACGGCGACGCCGCGCTCACGGCGCTCGGCGGCGAGGCGTACGACCTGCTGCTGCTCGATCTCGGCC
TGCCGAAACGCGACGGCATCGACGTGCTGCGCACGCTGCGTGCGCGCGGGCTGTCGCTGCCGGTGCTGATCGTCACCGCG
CGCGATGCGGTCGCCGATCGCGTGAAGGGGCTCGACGCGGGTGCCGACGACTACCTCGTCAAGCCGTTCGACCTCGACGA
ACTGGGTGCGCGGATGCGCGCGCTGATCCGCCGCCAGGCCGGGCGCAGCGAGTCGCTGATCCGCCACGGCGCGCTGACGC
TCGATCCCGCGTCGCACCAGGTGACGCTCGACGGCGCGCCCGTCGCGCTGTCCGCGCGCGAGTTCGCGCTGCTCCAGGCG
CTGCTGGCGCGGCCCGGCGCGGTGCTGTCGAAGAGCCAGCTCGAGGAGAAGATGTACGGCTGGGGCGAGGAGATCGGCAG
CAACACGGTCGAGGTCTACATCCACGCGCTGCGCAAGAAGCTCGGTTCGGACCTGATCCGCAACGTGCGCGGGCTCGGCT
ACATGGTCGTCAAGGAAAGCTGA

Protein sequence : 
MRILLVEDDRMIAEGVRKALRADGFAVDWVQDGDAALTALGGEAYDLLLLDLGLPKRDGIDVLRTLRARGLSLPVLIVTA
RDAVADRVKGLDAGADDYLVKPFDLDELGARMRALIRRQAGRSESLIRHGALTLDPASHQVTLDGAPVALSAREFALLQA
LLARPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGSDLIRNVRGLGYMVVKES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 4e-39 50
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-28 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bamb_2665 YP_774555.1 two component transcriptional regulator BAC0487 Protein 7e-37 48
Bamb_2665 YP_774555.1 two component transcriptional regulator BAC0197 Protein 9e-34 45
Bamb_2665 YP_774555.1 two component transcriptional regulator BAC0083 Protein 4e-31 44
Bamb_2665 YP_774555.1 two component transcriptional regulator BAC0638 Protein 2e-24 44
Bamb_2665 YP_774555.1 two component transcriptional regulator NC_002516.2.879194.p Protein 3e-29 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bamb_2665 YP_774555.1 two component transcriptional regulator VFG0473 Protein 3e-39 48
Bamb_2665 YP_774555.1 two component transcriptional regulator VFG1390 Protein 1e-37 46
Bamb_2665 YP_774555.1 two component transcriptional regulator VFG0596 Protein 6e-29 43
Bamb_2665 YP_774555.1 two component transcriptional regulator VFG1389 Protein 8e-29 42