Gene Information

Name : feuP (RL1433)
Accession : YP_767037.1
Strain : Rhizobium leguminosarum 3841
Genome accession: NC_008380
Putative virulence/resistance : Virulence
Product : two-component response regulator transcriptional regulatory protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1489705 - 1490376 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence : 
ATGCGCATCCTGGTAGTCGAAGACGACGTTAATCTGAACCGGCAGCTGGCCGACACGCTGAAGGAGGCGGGCTATGTCGT
CGACCAGGCGTTCGATGGCGAGGAAGGCCATTTCCTCGGCGACACCGAACCCTATGACGCCATCATCCTCGATATCGGCC
TGCCGGAGTTGGACGGGGTCACCGTTCTTGAAAAATGGCGTGGCGCCGGCCGCGGCGTGCCGGTGCTGATCCTGACGGCG
CGCGACCGCTGGAGCGACAAGGTCGCCGGCATCGATGCCGGTGCCGACGACTACGTCACCAAGCCCTTCCATGTCGAGGA
AGTGCTGGCCCGCATTCGGGCATTGATCCGGCGCGCGGCGGGGCATTCCTCATCCGAGATCATCTGCGGGCCGGTGCGGC
TCGATACCAAGTCCTCGAAGGCGACGGTCAACGGCGCGACGCTGAAGCTGACCTCGCACGAATATCGCCTGCTTTCCTAT
CTCATGCATCACATGGGCGAGGTCGTCTCGCGCACGGAACTGGTCGAGCATATGTATGACCAGGATTTCGACCGTGATTC
CAACACGATCGAGGTCTTCGTCGGCCGCCTGCGCAAGAAAATGGGGGTCGACCTGATCGAAACGGTGCGCGGTCTCGGTT
ACCGTATCCAAGCGCCGAAACATGCGAATTAA

Protein sequence : 
MRILVVEDDVNLNRQLADTLKEAGYVVDQAFDGEEGHFLGDTEPYDAIILDIGLPELDGVTVLEKWRGAGRGVPVLILTA
RDRWSDKVAGIDAGADDYVTKPFHVEEVLARIRALIRRAAGHSSSEIICGPVRLDTKSSKATVNGATLKLTSHEYRLLSY
LMHHMGEVVSRTELVEHMYDQDFDRDSNTIEVFVGRLRKKMGVDLIETVRGLGYRIQAPKHAN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-25 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-25 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein CP000647.1.gene1136. Protein 1e-35 46
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein NC_002516.2.879194.p Protein 4e-38 46
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein BAC0530 Protein 1e-35 46
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein CP001918.1.gene2526. Protein 3e-35 45
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein CP001138.1.gene1939. Protein 4e-36 45
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein NC_002695.1.913289.p Protein 2e-35 44
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein CP000034.1.gene2022. Protein 6e-36 44
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein CP004022.1.gene1005. Protein 7e-40 43
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein BAC0487 Protein 2e-26 43
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein BAC0347 Protein 1e-27 42
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein BAC0111 Protein 5e-30 42
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein BAC0308 Protein 5e-26 42
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein BAC0083 Protein 1e-28 41
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein BAC0197 Protein 7e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein VFG0475 Protein 4e-36 45
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein VFG0596 Protein 5e-26 44
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein VFG1390 Protein 6e-26 42
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein VFG0473 Protein 8e-27 41
feuP YP_767037.1 two-component response regulator transcriptional regulatory protein VFG1389 Protein 2e-27 41