Gene Information

Name : pRL120647 (pRL120647)
Accession : YP_765152.1
Strain :
Genome accession: NC_008378
Putative virulence/resistance : Unknown
Product : transposon-related protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 699293 - 699640 bp
Length : 348 bp
Strand : +
Note : similarity:fasta; SWALL:Q70MR8 (EMBL:AJ563381); Pseudomonas fluorescens; TnpB protein; tnpB; length 114 aa; id=56.48; ungapped id=56.48; E()=2.6e-24; 108 aa overlap; query 1-108 aa; subject 1-108 aa; similarity:fasta; SWALL:Q8KW57 (EMBL:AF416331); Ruegeri

DNA sequence :
ATGATCCCGGTTCCTGTTGGCGTGAAGGTGTGGTTGGCAACAGGTCATACCGACATGCGCAAAGGCTTCCCTGGTCTGTC
GTTGATGGTGCAGGAGGCGTTGAAGCGTGATCCGATGTGCGGCCACCTGTTCGTGTTCCGCGGCCGCGGTGGTGGCCTGA
TCAAAGTGATCTGGCATGGCGGCCAGGGAGCCTGCCTGTTTACGAAGAAGCTGGAGCGTGGACGCTTCATCTGGCCATCA
GCGGCCGATGGCACGGTGGTGATTACGCCCGCGCAGCTCGGCCATCTACTGGAAGGTATCGACTGGCGGATGCCGCAAAA
GACCTGGCGGCCGACGTCGGCCGGATAA

Protein sequence :
MIPVPVGVKVWLATGHTDMRKGFPGLSLMVQEALKRDPMCGHLFVFRGRGGGLIKVIWHGGQGACLFTKKLERGRFIWPS
AADGTVVITPAQLGHLLEGIDWRMPQKTWRPTSAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-31 63
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-31 63
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-31 63
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-32 63
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-31 63
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-32 63
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-31 63
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-31 63
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-31 63
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-31 63
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-31 63
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-31 63
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 6e-25 62
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-31 62
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-31 60
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-31 60
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 7e-31 59
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 7e-29 55
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 7e-29 55
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 3e-28 53
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 3e-28 53
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-24 51
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 5e-27 51
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 5e-27 51
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-28 51

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pRL120647 YP_765152.1 transposon-related protein VFG0792 Protein 5e-32 63
pRL120647 YP_765152.1 transposon-related protein VFG1698 Protein 2e-32 63
pRL120647 YP_765152.1 transposon-related protein VFG1709 Protein 5e-32 63
pRL120647 YP_765152.1 transposon-related protein VFG1517 Protein 2e-25 62
pRL120647 YP_765152.1 transposon-related protein VFG1052 Protein 7e-32 62
pRL120647 YP_765152.1 transposon-related protein VFG1665 Protein 3e-31 59
pRL120647 YP_765152.1 transposon-related protein VFG1737 Protein 1e-28 51