Gene Information

Name : merP (HNE_1690)
Accession : YP_760396.1
Strain : Hyphomonas neptunium ATCC 15444
Genome accession: NC_008358
Putative virulence/resistance : Resistance
Product : mercuric transport protein, periplasmic component
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1731026 - 1731301 bp
Length : 276 bp
Strand : +
Note : identified by match to protein family HMM PF00403

DNA sequence : 
ATGGGCGGAATGGCGCTTGCTGGCGCGCAGTTCTCGCAGACAGAGGTCGCAGAAGTACAGCAGGCCACGGCCCGCTTTTC
CGTCGACAACATGACCTGCGCAACATGTCCCATATCGGTGAAAAAGGCGATGCTGCGCGTCGATGGCGTCAAGTCTGTTG
AGATCGATTTTGGGACGAAGACTGCAGAGGTCGTGTATGATCCGGCGATCACGTCTCCGGAAACAATTGCCGCCGCATCG
GCCGGCGTCGGGTATCCGGCGGTCCAGACCAGTTGA

Protein sequence : 
MGGMALAGAQFSQTEVAEVQQATARFSVDNMTCATCPISVKKAMLRVDGVKSVEIDFGTKTAEVVYDPAITSPETIAAAS
AGVGYPAVQTS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 3e-10 42
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-10 42
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-10 42
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-10 42
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-10 42
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-10 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merP YP_760396.1 mercuric transport protein, periplasmic component BAC0675 Protein 4e-12 50
merP YP_760396.1 mercuric transport protein, periplasmic component BAC0678 Protein 5e-11 47
merP YP_760396.1 mercuric transport protein, periplasmic component BAC0231 Protein 1e-10 45