Gene Information

Name : Mmar10_0483 (Mmar10_0483)
Accession : YP_755714.1
Strain : Maricaulis maris MCS10
Genome accession: NC_008347
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 568794 - 569483 bp
Length : 690 bp
Strand : +
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ccr:CC0294 phosphate regulon response regulator PhoB

DNA sequence :
ATGAAAGCCCATGTCCTTGTTGTAGAAGACGAAGATGCCCTGGCCACCCTGCTGCAGTACAATCTGGAGAAGGAAGGCTA
TTCGGTCGCGGTCGCCCGCGATGGTGAAGATGCCCTGATGCAGGCCGAGGAAACCACGCCCGATCTGGTGATGGTCGACT
GGATGCTGCCGAAAGTCTCGGGCATCGAAGTCTGCCGCCGGCTGCGTGGCCGCCAGGAAACGGCCAATGTCCCGATCATC
ATGCTGACAGCGCGCGGTGAGGAGACGGATCGTGTGCGTGGTCTGGATACCGGCGCCGACGACTATGTCGTGAAGCCCTT
CTCGATGACCGAGCTGTTCGCCCGTATCCGCGCCGTCCTGCGCCGGATCCGCCCGGGCCTCGCCGAGGATGTGATCGAGG
CCGGCGACATCACCATGGACCGGGTCGCGCACCGTGTGAAACGGGCCGATCGCGAGATTCATCTCGGGCCGACCGAGTTT
CGCCTGCTGGACTATCTGATGCAGCACCCGGGGCGGGTCTTCTCGCGTGAGCAATTGCTGGACGCGGTCTGGGGTTCGGA
CGTCTATGTCGAGGCCCGCACGGTTGACGTCCATGTCGGACGCTTGCGCAAGGCGCTCAACAACAAGGAAGAACGCGACC
CGATCCGCACCGTCCGCTCGGCCGGGTATGCGTTTGACGTGAATGCGTGA

Protein sequence :
MKAHVLVVEDEDALATLLQYNLEKEGYSVAVARDGEDALMQAEETTPDLVMVDWMLPKVSGIEVCRRLRGRQETANVPII
MLTARGEETDRVRGLDTGADDYVVKPFSMTELFARIRAVLRRIRPGLAEDVIEAGDITMDRVAHRVKRADREIHLGPTEF
RLLDYLMQHPGRVFSREQLLDAVWGSDVYVEARTVDVHVGRLRKALNNKEERDPIRTVRSAGYAFDVNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mmar10_0483 YP_755714.1 two component transcriptional regulator HE999704.1.gene2815. Protein 4e-41 48
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-44 45
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-43 45
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-43 45
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-43 45
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-43 45
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-43 45
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-44 45
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-43 45
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-43 45
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-43 45
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-40 44
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-40 44
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-40 44
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-40 44
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-40 44
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-40 44
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-40 44
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-40 44
Mmar10_0483 YP_755714.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-35 42
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-42 42
Mmar10_0483 YP_755714.1 two component transcriptional regulator CP001485.1.gene721.p Protein 7e-35 42
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_012469.1.7685629. Protein 8e-38 42
Mmar10_0483 YP_755714.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-36 42
Mmar10_0483 YP_755714.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-31 41
Mmar10_0483 YP_755714.1 two component transcriptional regulator BAC0125 Protein 1e-31 41
Mmar10_0483 YP_755714.1 two component transcriptional regulator NC_002516.2.879194.p Protein 7e-32 41
Mmar10_0483 YP_755714.1 two component transcriptional regulator BAC0533 Protein 4e-29 41
Mmar10_0483 YP_755714.1 two component transcriptional regulator CP000647.1.gene4257. Protein 4e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mmar10_0483 YP_755714.1 two component transcriptional regulator VFG1390 Protein 2e-40 43
Mmar10_0483 YP_755714.1 two component transcriptional regulator VFG1702 Protein 2e-35 41
Mmar10_0483 YP_755714.1 two component transcriptional regulator VFG1386 Protein 4e-31 41