Gene Information

Name : Sfri_0485 (Sfri_0485)
Accession : YP_749185.1
Strain : Shewanella frigidimarina NCIMB 400
Genome accession: NC_008345
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 551424 - 552158 bp
Length : 735 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: sde:Sde_3703 response regulator receiver domain protein (CheY-like)

DNA sequence :
ATGAATGGAACCGCGAAACATAATGGCCATGTTTGTCCGCAACATATTTTGCTAGTCGAAGACGAACAAGACTTGGCTAA
GTTAATCATACTTAACCTCAAAGCACTCAACTACAGCGTCGACCACGCCACCACCTTGAAGCAAGCCATGCACATAATCG
AGCATAAAAAGCTCGACCTTATATTAATGGATCGCATGCTCCCCGATGGTGATGGCATTATGCTGTGTGAGCAACTACGC
CAAGACGGTAAGGAAGTTCCACTGATGCTACTAACCGCCAAAGATTCAGAAGCAGATGTGGTACTTGGTCTTGAAGCTGG
GGCAGATGATTACCTCGTCAAACCTTTTAGCGTATTAGAGCTGCGCGCACGAGTAAAAGCACTATTAAGACGCGGCAAAA
CGCAACATGAACAAACACAACAAATTGAATTTAACAGCGTATCCATTAACTCCAGCACCCGTGAAGTTACCGCCTTTAAT
AAAGCGTTAACCCTCACCGCCCGCGAGTTTGATTTACTGCTATTTTTAGCCAAACACCCGCAACAAGTCTTTAGCCGCAT
GCAACTGCTAGAAGCGGTATGGGGCTATAACTACGATGGCTATGAGCACACTGTAAACAGCCACATCAACCGTTTACGCA
ACAAGCTTTCTTTGTGCTCGCCTGAACATGATCTTGTCAAAACCGTGTGGGGCGTAGGCTACAAATTTTCACCACCAGAG
GTGCAAGCCCACTAA

Protein sequence :
MNGTAKHNGHVCPQHILLVEDEQDLAKLIILNLKALNYSVDHATTLKQAMHIIEHKKLDLILMDRMLPDGDGIMLCEQLR
QDGKEVPLMLLTAKDSEADVVLGLEAGADDYLVKPFSVLELRARVKALLRRGKTQHEQTQQIEFNSVSINSSTREVTAFN
KALTLTAREFDLLLFLAKHPQQVFSRMQLLEAVWGYNYDGYEHTVNSHINRLRNKLSLCSPEHDLVKTVWGVGYKFSPPE
VQAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-42 46
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-42 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein HE999704.1.gene2815. Protein 3e-36 43
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein NC_009782.5559369.p0 Protein 4e-38 42
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein NC_002951.3237708.p0 Protein 4e-38 42
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein NC_003923.1003749.p0 Protein 4e-38 42
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein NC_002758.1121668.p0 Protein 4e-38 42
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein NC_007622.3794472.p0 Protein 2e-38 42
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein NC_009641.5332272.p0 Protein 4e-38 42
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein NC_013450.8614421.p0 Protein 4e-38 42
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein NC_007793.3914279.p0 Protein 4e-38 42
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein NC_002745.1124361.p0 Protein 4e-38 42
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein NC_002952.2859905.p0 Protein 3e-38 42
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein AE000516.2.gene3505. Protein 4e-33 42
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein CP001918.1.gene3444. Protein 4e-28 42
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein AE015929.1.gene1106. Protein 3e-25 41
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein NC_012469.1.7686381. Protein 3e-39 41
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein DQ212986.1.gene4.p01 Protein 4e-32 41
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein NC_012469.1.7685629. Protein 2e-33 41
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein CP000034.1.gene2186. Protein 3e-29 41
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein CP001138.1.gene2239. Protein 5e-29 41
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein NC_002695.1.916589.p Protein 4e-29 41
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein BAC0039 Protein 3e-29 41
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein BAC0596 Protein 5e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein VFG1563 Protein 2e-42 46
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein VFG1702 Protein 2e-42 46
Sfri_0485 YP_749185.1 two component transcriptional regulator, winged helix family protein VFG1389 Protein 1e-29 41