
|
Name : Neut_0032 (Neut_0032) Accession : YP_746287.1 Strain : Nitrosomonas eutropha C91 Genome accession: NC_008344 Putative virulence/resistance : Resistance Product : mercuric transport periplasmic protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 34878 - 35153 bp Length : 276 bp Strand : - Note : TIGRFAM: mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein; KEGG: rme:Rmet_6173 mercuric transport protein periplasmic component DNA sequence : ATGAAAAAACTGTTTGCCTCCTTCGCACTCGCTGCCGTTGTTGCTCCTGTGTGGGCGGTCACCCAGACCGTCACACTCTC TGTACCCGGCATGACTTGCTCGACCTGCCCGATTACCGTCAAGAAGGCGATTTCCAAGGTCGAAGGCGTCAGCAAAGTTG ACGTGACCTTCGAGACACGCGAAGCGGTTGTCACGTTCGATGATGCCAAGACCAGCGTGCAGAAGCTGACCAAGGCAACC GGAGACGCGGGCTATCCATCTTCAGTCAAGAACTAA Protein sequence : MKKLFASFALAAVVAPVWAVTQTVTLSVPGMTCSTCPITVKKAISKVEGVSKVDVTFETREAVVTFDDAKTSVQKLTKAT GDAGYPSSVKN |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 4e-22 | 85 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 4e-22 | 85 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 4e-22 | 85 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 4e-22 | 85 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 6e-22 | 85 |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 4e-22 | 85 |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 4e-21 | 81 |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 3e-21 | 81 |
| unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 6e-21 | 78 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Neut_0032 | YP_746287.1 | mercuric transport periplasmic protein | BAC0679 | Protein | 4e-24 | 96 |
| Neut_0032 | YP_746287.1 | mercuric transport periplasmic protein | BAC0231 | Protein | 2e-23 | 94 |
| Neut_0032 | YP_746287.1 | mercuric transport periplasmic protein | BAC0678 | Protein | 9e-24 | 94 |
| Neut_0032 | YP_746287.1 | mercuric transport periplasmic protein | BAC0675 | Protein | 4e-19 | 72 |
| Neut_0032 | YP_746287.1 | mercuric transport periplasmic protein | BAC0674 | Protein | 9e-15 | 58 |