Gene Information

Name : Neut_2566 (Neut_2566)
Accession : YP_743747.1
Strain :
Genome accession: NC_008341
Putative virulence/resistance : Resistance
Product : transcriptional regulator MerD
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 41041 - 41406 bp
Length : 366 bp
Strand : -
Note : TIGRFAM: mercuric resistence transcriptional repressor protein MerD; PFAM: regulatory protein, MerR; KEGG: sty:HCM1.159 putative mercuric resistance operon coregulator

DNA sequence :
ATGAGCGCCTACACAGTGTCCCGGCTGGCCCTTGATGCCGGGGTGAGCGTGCATATCGTGCGCGACTACCTGCTGCGCGG
ATTGCTACGGCCGGTCGCGTGCACCACGGGCGGCTACGGCTTGTTCGATGACACCGCGTTGCAACGGCTGCGCTTTGTAC
GGGCTGCCTTCGAAGCGGGTATCGGCCTGGACGCACTGGCGCGGCTGTGCCGGGCGCTGGATGCTGCGGACGGTGACGGT
GCGTCTGCGCAGCTTGCCGTGTTGCGGCAACTCGTCGAGCGTCGGCGCGAGGCCCTGGCCAGCCTCGAAATGCAACTGGC
CGCCATGCCAACCGAACCGGCACAGCACGCGGAGAGTCTGCCATGA

Protein sequence :
MSAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTTGGYGLFDDTALQRLRFVRAAFEAGIGLDALARLCRALDAADGDG
ASAQLAVLRQLVERRREALASLEMQLAAMPTEPAQHAESLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merD ACN81004.1 MerD Not tested AbaR5 Protein 5e-35 99
merD CAJ77059.1 Mercury operon coregulator protein Not tested AbaR1 Protein 6e-35 99
merD AGK07020.1 MerD Not tested SGI1 Protein 2e-32 91
merD AGK07078.1 MerD Not tested SGI1 Protein 2e-32 91
merD ABQ57370.1 MerD Not tested SGI1 Protein 5e-32 90
merD AET25396.1 MerD Not tested PAGI-2(C) Protein 2e-28 84
merD AFG30119.1 MerD Not tested PAGI-2 Protein 2e-28 84
merD YP_006098386.1 MerR family transcriptional regulator Not tested Tn2411 Protein 3e-28 84
merD ACF06181.1 mercuric resistance protein Not tested Tn5036-like Protein 2e-28 84

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Neut_2566 YP_743747.1 transcriptional regulator MerD BAC0668 Protein 1e-32 91
Neut_2566 YP_743747.1 transcriptional regulator MerD BAC0665 Protein 1e-33 91
Neut_2566 YP_743747.1 transcriptional regulator MerD BAC0666 Protein 8e-33 91
Neut_2566 YP_743747.1 transcriptional regulator MerD BAC0667 Protein 2e-34 90
Neut_2566 YP_743747.1 transcriptional regulator MerD BAC0227 Protein 2e-32 90
Neut_2566 YP_743747.1 transcriptional regulator MerD BAC0669 Protein 1e-33 85