Gene Information

Name : H16_B0903 (H16_B0903)
Accession : YP_729060.1
Strain :
Genome accession: NC_008314
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1024556 - 1024996 bp
Length : 441 bp
Strand : -
Note : -

DNA sequence :
ATGGAGCACACACTAACAATCGGGAAGCTGGCCAAGGCGGCTGGTGTTGGCGTGGAGACGGTACGCTACTACCATCGGTG
CGGCCTGCTGCCGGTGCCGGAGCGTGCCTATGGCGCCATTCGACAGTATTCGCAGCAGAGCTTGCAGCGGCTTCATTTCA
TTCGCCAGGCCCAGTCGCTCGGGTTCACCCTGGATGAAATCCGGGTACTGCTGCGACAGAACGATGGCAGCACGTGCAGT
ACAGCCCGCGCGCTGGCCGAGCAAAAGCTCAGTCTTGTTGAGGAAAGAATGAAGGATCTGCGACGAATGCGAGCGGAACT
GAAGAATCTCATTGGGCAATGCCACGCCAATGGCAATGAGGCTTCTTGTCCCTTGATTGACACCTTGTCTGCCAACATGA
GAGCAGAGAACGCTCGTGACGCTCCATTTCGGCATCGGTGA

Protein sequence :
MEHTLTIGKLAKAAGVGVETVRYYHRCGLLPVPERAYGAIRQYSQQSLQRLHFIRQAQSLGFTLDEIRVLLRQNDGSTCS
TARALAEQKLSLVEERMKDLRRMRAELKNLIGQCHANGNEASCPLIDTLSANMRAENARDAPFRHR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 8e-32 51
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 3e-32 51
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 2e-32 51
merR AFG30124.1 MerR Not tested PAGI-2 Protein 3e-31 51
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 4e-31 51
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-31 51
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-31 51
merR ACK44535.1 MerR Not tested SGI1 Protein 3e-31 51
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 3e-31 51
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 5e-29 50
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 1e-28 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H16_B0903 YP_729060.1 MerR family transcriptional regulator BAC0688 Protein 1e-32 54
H16_B0903 YP_729060.1 MerR family transcriptional regulator BAC0687 Protein 3e-31 52
H16_B0903 YP_729060.1 MerR family transcriptional regulator BAC0686 Protein 6e-33 52
H16_B0903 YP_729060.1 MerR family transcriptional regulator BAC0232 Protein 3e-31 52
H16_B0903 YP_729060.1 MerR family transcriptional regulator BAC0683 Protein 2e-32 50
H16_B0903 YP_729060.1 MerR family transcriptional regulator BAC0684 Protein 2e-32 50
H16_B0903 YP_729060.1 MerR family transcriptional regulator BAC0689 Protein 5e-31 48
H16_B0903 YP_729060.1 MerR family transcriptional regulator BAC0682 Protein 2e-20 42
H16_B0903 YP_729060.1 MerR family transcriptional regulator BAC0058 Protein 4e-21 41