Gene Information

Name : H16_B1647 (H16_B1647)
Accession : YP_841162.1
Strain :
Genome accession: NC_008314
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1860445 - 1861134 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
ATGCGTATCCTGATTGTCGAGGACGAACCCAAGGCGGGCGACTACCTGCACAAGGGCCTGACCGAATCCGGCTTCGTGGT
GGACCTGGCGCGCGACGGCGCGGATGGCCTGGCCCATGCGCGCGAGCATCCCTATGACCTGATCGTGCTGGACGTGATGC
TGCCCGGCCTGGATGGCTGGCAGGTGCTGCGCGAGCTGCGCCGCGAGCGCGATACCCCGGTGCTGTTCCTGACCGCGCGC
GACGAGCTGTCCGACCGCCTCAAGGGGCTGGAGCTCGGCGCCGACGACTATATGGTCAAGCCCTTTGCCTTTGCCGAGCT
GGTGCTGCGCATCCGCACCATCCTGCGGCGCGGCCCGCTGCGCGAGAGCGAGTTCATCGAAGTGGCCGACCTGCAGATCG
ACGCCATCCGCCGCCGCGTGGTGCGCGCCGGCCAGAAGATCGACCTGACCTCCAAGGAGTTCGCACTGCTGTACCTGCTC
GCGCGCCGGCGCGGCGAGGTGCTGTCGCGCTCGCTGATCGCCTCGCAGGTGTGGGACGTCAACTTCGACAGCAATACCAA
TGTGGTCGATGTCTCGATCCGGCGCCTGCGCGCCAAGGTCGACGATCCCTTCCCGCATAAGCTGATCCACACGCGGCGCG
GCATGGGCTACGTGCTGGACGACAGCGAGGACCGGGACCAGGACGCATGA

Protein sequence :
MRILIVEDEPKAGDYLHKGLTESGFVVDLARDGADGLAHAREHPYDLIVLDVMLPGLDGWQVLRELRRERDTPVLFLTAR
DELSDRLKGLELGADDYMVKPFAFAELVLRIRTILRRGPLRESEFIEVADLQIDAIRRRVVRAGQKIDLTSKEFALLYLL
ARRRGEVLSRSLIASQVWDVNFDSNTNVVDVSIRRLRAKVDDPFPHKLIHTRRGMGYVLDDSEDRDQDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-59 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-58 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H16_B1647 YP_841162.1 response regulator BAC0197 Protein 2e-70 66
H16_B1647 YP_841162.1 response regulator BAC0125 Protein 1e-71 65
H16_B1647 YP_841162.1 response regulator BAC0638 Protein 2e-61 63
H16_B1647 YP_841162.1 response regulator BAC0083 Protein 3e-67 61
H16_B1647 YP_841162.1 response regulator BAC0308 Protein 2e-64 59
H16_B1647 YP_841162.1 response regulator BAC0111 Protein 5e-63 58
H16_B1647 YP_841162.1 response regulator BAC0347 Protein 7e-55 54
H16_B1647 YP_841162.1 response regulator NC_002952.2859858.p0 Protein 9e-43 46
H16_B1647 YP_841162.1 response regulator NC_007622.3794948.p0 Protein 9e-43 46
H16_B1647 YP_841162.1 response regulator NC_003923.1003417.p0 Protein 9e-43 46
H16_B1647 YP_841162.1 response regulator NC_013450.8614146.p0 Protein 9e-43 46
H16_B1647 YP_841162.1 response regulator NC_002951.3238224.p0 Protein 9e-43 46
H16_B1647 YP_841162.1 response regulator NC_007793.3914065.p0 Protein 9e-43 46
H16_B1647 YP_841162.1 response regulator NC_002758.1121390.p0 Protein 9e-43 46
H16_B1647 YP_841162.1 response regulator NC_010079.5776364.p0 Protein 9e-43 46
H16_B1647 YP_841162.1 response regulator AE015929.1.gene1106. Protein 3e-37 44
H16_B1647 YP_841162.1 response regulator HE999704.1.gene2815. Protein 7e-32 42
H16_B1647 YP_841162.1 response regulator AE000516.2.gene3505. Protein 1e-31 42
H16_B1647 YP_841162.1 response regulator NC_002951.3237708.p0 Protein 7e-34 41
H16_B1647 YP_841162.1 response regulator NC_002952.2859905.p0 Protein 6e-34 41
H16_B1647 YP_841162.1 response regulator NC_002758.1121668.p0 Protein 7e-34 41
H16_B1647 YP_841162.1 response regulator NC_009641.5332272.p0 Protein 7e-34 41
H16_B1647 YP_841162.1 response regulator NC_013450.8614421.p0 Protein 7e-34 41
H16_B1647 YP_841162.1 response regulator NC_007793.3914279.p0 Protein 7e-34 41
H16_B1647 YP_841162.1 response regulator NC_007622.3794472.p0 Protein 5e-34 41
H16_B1647 YP_841162.1 response regulator NC_002745.1124361.p0 Protein 7e-34 41
H16_B1647 YP_841162.1 response regulator NC_009782.5559369.p0 Protein 7e-34 41
H16_B1647 YP_841162.1 response regulator HE999704.1.gene1528. Protein 2e-28 41
H16_B1647 YP_841162.1 response regulator BAC0596 Protein 3e-26 41
H16_B1647 YP_841162.1 response regulator BAC0039 Protein 2e-26 41
H16_B1647 YP_841162.1 response regulator CP001138.1.gene2239. Protein 3e-26 41
H16_B1647 YP_841162.1 response regulator CP000034.1.gene2186. Protein 2e-26 41
H16_B1647 YP_841162.1 response regulator NC_002695.1.916589.p Protein 2e-26 41
H16_B1647 YP_841162.1 response regulator CP001918.1.gene5135. Protein 2e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H16_B1647 YP_841162.1 response regulator VFG0596 Protein 1e-59 56
H16_B1647 YP_841162.1 response regulator VFG1389 Protein 9e-35 47
H16_B1647 YP_841162.1 response regulator VFG1386 Protein 1e-36 44
H16_B1647 YP_841162.1 response regulator VFG1390 Protein 4e-37 43