Gene Information

Name : terD (HS_0633)
Accession : YP_718845.1
Strain : Haemophilus somnus 129PT
Genome accession: NC_008309
Putative virulence/resistance : Resistance
Product : stress response protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 679642 - 680220 bp
Length : 579 bp
Strand : +
Note : tellurium resistance protein

DNA sequence :
ATGGCTGTATCTTTAAGTAAAGGTCAAAATGTTTCATTAAGTAAAACCGATCCACATCTTAACAAGGTGTTAATCGGTTT
AGGCTGGGACGCTCGTAGCACAGACGGCGCAGATTTTGATCTTGATGCTAGTGTATTTATGACCGGTGAAAACGGCAAAG
TGATTTCTGACAATCATTTTGTTTTCTATAACAATTTACGCTCACCTTGTGGTTCGGTTGAACACACGGGGGATAACTTA
ACAGGGGACGGCGACGGCGATGATGAGTCCATTATTGTTGATCTCACCGCAGTGCCGGCAAACATTAAATCCATTTTTAT
TACCGTCACGATCCACGATGCTGAAGCAAGACGACAAAATTTTGGGCAAGTTTCCGATGCATTCATTCGTTTAGTGAATC
ACGAAAGAGATGAAGAAGTCGTACGTTTTGATCTTTCCGAAGATTACAGCACCGAAACTGCAATGGTCTTCGGTGAAGTC
TATCGTTATAACAGCGAATGGAAATTCCGAGCAATCGGGCAGGGTTATAGCGGTGGTTTGTATGCCCTTTGCCAGCAATA
TGGTGTGAATGTGGGGTAA

Protein sequence :
MAVSLSKGQNVSLSKTDPHLNKVLIGLGWDARSTDGADFDLDASVFMTGENGKVISDNHFVFYNNLRSPCGSVEHTGDNL
TGDGDGDDESIIVDLTAVPANIKSIFITVTIHDAEARRQNFGQVSDAFIRLVNHERDEEVVRFDLSEDYSTETAMVFGEV
YRYNSEWKFRAIGQGYSGGLYALCQQYGVNVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-57 67
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-57 67
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 9e-57 67
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-52 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-52 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-52 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-56 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-52 62

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD YP_718845.1 stress response protein BAC0389 Protein 4e-57 67
terD YP_718845.1 stress response protein BAC0390 Protein 1e-55 63