Gene Information

Name : terE (FRAAL5898)
Accession : YP_716042.1
Strain : Frankia alni ACN14a
Genome accession: NC_008278
Putative virulence/resistance : Resistance
Product : tellurium resistance protein terE
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 6399019 - 6399594 bp
Length : 576 bp
Strand : -
Note : Evidence 2b : Function of strongly homologous gene; PubMedId : 11467730; Product type e : enzyme

DNA sequence :
GTGGGAGTCAGTCTCAGCAAGGGCGGCAACGTGTCGCTGTCCAAGGAGGCGCCCGGCCTGACCAACATCCTGGTCGGCCT
CGGCTGGGACGTGCGCAGCACGACCGGCGCCGACTTCGACCTCGACGCCAGCGCCATCGCGTGCCGCGCCGACGGCAAGG
TGGTCTCGGACGGGCACTTCGTCTTCTTCAACAACCTCAAGAGCCCCGAGGGCGCGATCGAGCACCAGGGCGACAACCTC
ACCGGCGAGGGTGAGGGCGACGACGAGGCCATCTCCGTGAACCTCACGTCGTTGCCCGCGGAGATCGACAAGATCGTTTT
CCCGGTCTCCATCTACGACGCGGACTCGCGCCAGCAGAACTTCGGCCAGGTCCGCAACGCCTTCATCCGGATCGTCAACG
GCGCCGGCGGCACCGAGATCGCCCGCTACGACCTCACCGAGGACGCCTCCACCGAGACGGCCATGGTGTTCGGCGAGGTC
TACCGGCACGGATCGGACTGGAAGTTCCGCGCCGTCGGCCAGGGCTACGCCTCGGGCCTGGCCGGGATCGCCCGCGACTA
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLSKEAPGLTNILVGLGWDVRSTTGADFDLDASAIACRADGKVVSDGHFVFFNNLKSPEGAIEHQGDNL
TGEGEGDDEAISVNLTSLPAEIDKIVFPVSIYDADSRQQNFGQVRNAFIRIVNGAGGTEIARYDLTEDASTETAMVFGEV
YRHGSDWKFRAVGQGYASGLAGIARDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-61 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-60 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-60 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-60 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-59 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-59 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 8e-59 64
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-56 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-29 43
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-26 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terE YP_716042.1 tellurium resistance protein terE BAC0389 Protein 5e-59 65
terE YP_716042.1 tellurium resistance protein terE BAC0390 Protein 3e-60 63
terE YP_716042.1 tellurium resistance protein terE BAC0392 Protein 7e-26 41