Gene Information

Name : FRAAL5064 (FRAAL5064)
Accession : YP_715244.1
Strain : Frankia alni ACN14a
Genome accession: NC_008278
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 5494893 - 5495483 bp
Length : 591 bp
Strand : -
Note : Evidence 2b : Function of strongly homologous gene

DNA sequence :
GTGTGGGTCATGACGTCCGTGTCGCTGTCCAAGGGCGGAAATGTCTCGCTGAGCAAGGTCGCTCCCAACCTCACGGCCGT
GACCATCGGGCTGGGCTGGAAGGTGCGGCAGACCAGCGGCGCCGACTATGACCTCGACGCGAGCGCGATCGTCGTCAACG
AGGCCGGCCGGGTGCTCTCCGACAGCTACTTCGTCTTCTTCAACAACCTCGTCAGCCCCGACGGCGGGGTCACCCACCTC
GGCGACAACCTGGTCGGCGGCGGTGGCGGTGACGACGAACAGATCAACGTCGACCTGCGGACGTTGACCCCACAGGCGGC
GAAGGTCGTGTTCGCGGTGTCGATCTACGATGCGGATGCCCGCCGGCAGACCTTCGGCCAGATCCGTGACGCCTTCATCC
GGGTCACCGACGCCACGACCGGTGCCGAGGTCGCCCGCTACGACCTCACCGAGGACGCCTCCACCGAGACCGCGATGATC
TTCGGTGAGCTGTACCGCTACGGCGGCGAGTGGAAGTTCCGCGCCGTCGGCCAGGGCTACGCCTCCGGGCTGCGCGGAAT
CGCCCTGGACTTCGGCGTCAACGTCTCCTGA

Protein sequence :
MWVMTSVSLSKGGNVSLSKVAPNLTAVTIGLGWKVRQTSGADYDLDASAIVVNEAGRVLSDSYFVFFNNLVSPDGGVTHL
GDNLVGGGGGDDEQINVDLRTLTPQAAKVVFAVSIYDADARRQTFGQIRDAFIRVTDATTGAEVARYDLTEDASTETAMI
FGELYRYGGEWKFRAVGQGYASGLRGIALDFGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-50 60
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-51 60
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-51 60
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-50 59
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-51 59
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-51 59
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-51 59
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-50 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FRAAL5064 YP_715244.1 tellurium resistance protein BAC0389 Protein 1e-49 59
FRAAL5064 YP_715244.1 tellurium resistance protein BAC0390 Protein 1e-51 58