Gene Information

Name : FRAAL3821 (FRAAL3821)
Accession : YP_714024.1
Strain : Frankia alni ACN14a
Genome accession: NC_008278
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4098919 - 4099659 bp
Length : 741 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type r : regulator

DNA sequence :
ATGCGGGTCCTGGTCGTGGAGGACGAGGTGCGCACCGCCGCGGTGCTGCGCCGGGGCCTCGTCGAGGAGGGGTACGCCGT
CGACGTCGTCGGCGACGGGATCGACGCCGTCTGGCGGGCCACCGAGATCGCCTACGACGCGATCGTCCTGGATCTCATGC
TGCCCGGCATCGACGGCTTCGAGGTGTGCCGCCGGCTGCGCGCCGGCCATCGCTGGGCGCCCGTGCTCATGCTCACCGCG
CGTGTCGACGTCGACGACCGCATCCGCGGCCTGGACGCCGGCGCCGACGACTACCTGCCCAAGCCGTTCAGCTTCGGCGA
GCTCACCGCCCGGCTGCGCGCGCTGGTCCGCCGCGGCGCGGTGCACCGGCCCGTCGTGCTGCGCGCCGGCGCGGTCGAAC
TCGACCCGGCCGGGCACCGGGTCTGGCGGGGCGGGGAGCCGGTCGACCTGTCCGCCAAGGAGTTCGCCCTGCTGCACCTG
CTGCTGCGCCATCCCGACCAGGTGCTCACCCGCACCTACATCACCGAACACGTCTGGGACGACGCGTTCGACGCCACCTC
CAACATCGTCGACCAGTACGTCCGCTACCTACGCCGCAAGATCGACCTGCCGCCGGCGCCCTCGCTCATCGAGACGGTCC
GCGGGGTCGGCTACCGCCTGTGCGTCCCGCTCACGCCGCTGCCGGCGGGGTCGGCGTTGCCGGCGGGGTCGGTGCCGCCG
GCCGCCGGCACCGGGACGTAG

Protein sequence :
MRVLVVEDEVRTAAVLRRGLVEEGYAVDVVGDGIDAVWRATEIAYDAIVLDLMLPGIDGFEVCRRLRAGHRWAPVLMLTA
RVDVDDRIRGLDAGADDYLPKPFSFGELTARLRALVRRGAVHRPVVLRAGAVELDPAGHRVWRGGEPVDLSAKEFALLHL
LLRHPDQVLTRTYITEHVWDDAFDATSNIVDQYVRYLRRKIDLPPAPSLIETVRGVGYRLCVPLTPLPAGSALPAGSVPP
AAGTGT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-32 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system BAC0197 Protein 2e-38 50
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system BAC0125 Protein 3e-40 50
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system BAC0083 Protein 9e-37 47
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system BAC0638 Protein 2e-29 46
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system BAC0308 Protein 3e-33 46
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system AE000516.2.gene3505. Protein 3e-29 44
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system BAC0111 Protein 5e-37 43
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system HE999704.1.gene1528. Protein 8e-28 42
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system U82965.2.orf14.gene. Protein 4e-18 42
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system NC_007622.3794948.p0 Protein 3e-29 41
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system NC_003923.1003417.p0 Protein 3e-29 41
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system NC_013450.8614146.p0 Protein 3e-29 41
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system NC_002951.3238224.p0 Protein 3e-29 41
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system NC_007793.3914065.p0 Protein 3e-29 41
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system NC_002758.1121390.p0 Protein 3e-29 41
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system NC_010079.5776364.p0 Protein 3e-29 41
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system NC_002952.2859858.p0 Protein 3e-29 41
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system Y16952.3.orf35.gene. Protein 7e-18 41
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system NC_008702.1.4607594. Protein 4e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system VFG1390 Protein 9e-36 46
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system VFG0596 Protein 5e-33 46
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system VFG1386 Protein 2e-34 45
FRAAL3821 YP_714024.1 response regulator in two-component regulatory system VFG1389 Protein 3e-29 45