Gene Information

Name : terE (FRAAL2316)
Accession : YP_712541.1
Strain : Frankia alni ACN14a
Genome accession: NC_008278
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2524171 - 2524746 bp
Length : 576 bp
Strand : -
Note : Evidence 2b : Function of strongly homologous gene; PubMedId : 7665479

DNA sequence :
GTGGGCATTGATCTCGCCAAGGGCGGCAGCGTCGCTCTTGCCGAAGCCACCGAGACCCTCACACACATCACGGTCGGTCT
CGGCTGGGATCCCAATCGTCCAGGCGGGGAGGAGTTCGATCTCGACGCGAGCGCCATCGCCCTGCAGGAGAACGACCGGG
CGCCCAGCCTGAGCTATTTCGTCTACTACAACAATCTGAGCAGCCCGCGTGGGGAGATCGTGCACCGCGGGGACAACCTC
ACGGGCGAGGGTGCGGGGGACGACGAGCAGATCGACGTGCGGCTCGACCTGTTGTCCAGCGCGATCACCCGCATCGTTTT
CCCGGTGAGCATCCACAACGCCGACTACCGGCACCAGAGTTTCGGTGACGTGCACGGCGCGTACATCCGGGTCGTCAACA
CCGACACCGGCGACGAGCTGGTGCGCTACGACCTGTCGAGCACCGCCGCGCGGGACACCTCGATGCTGTTCGGCGAGCTG
CACCGCGACAGCGGCGGCTGGCATTTTCGCGCCCTCGGCGAGGGCGGCATCGCCGGTCTGGCGCAGATCGCCCGCGGGTA
CGGTCTCGACGTCTGA

Protein sequence :
MGIDLAKGGSVALAEATETLTHITVGLGWDPNRPGGEEFDLDASAIALQENDRAPSLSYFVYYNNLSSPRGEIVHRGDNL
TGEGAGDDEQIDVRLDLLSSAITRIVFPVSIHNADYRHQSFGDVHGAYIRVVNTDTGDELVRYDLSSTAARDTSMLFGEL
HRDSGGWHFRALGEGGIAGLAQIARGYGLDV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-46 49
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-46 49
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-45 48
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-43 47
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-41 46
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-40 44
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-40 44
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-40 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terE YP_712541.1 tellurium resistance protein BAC0389 Protein 2e-45 47
terE YP_712541.1 tellurium resistance protein BAC0390 Protein 1e-42 46