Gene Information

Name : FRAAL1628 (FRAAL1628)
Accession : YP_711872.1
Strain : Frankia alni ACN14a
Genome accession: NC_008278
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : 3.1.1.61
Position : 1749517 - 1750251 bp
Length : 735 bp
Strand : -
Note : Evidence 2b : Function of strongly homologous gene; Product type r : regulator

DNA sequence :
ATGGCCCGCGTCCTCGTCGTCGACGACGACGCCCTCGTCGCCGAGGTCGTCGACCGCTACCTGCGCAACGCCGGCTTCGA
CGTCGACCGCGCCGCGGACGGCCCGAGCGCCCTGCGCACCGCCGAGGCCCGGCCGCCCGACCTCGTCGTCCTCGACCTGA
TGCTGCCCGGCCTCGACGGCCTCGAAGTCTTCCGCCGGCTGACGGCCCGCCGACCCGTCCCGGTCATCATGCTCACCGCG
CGTGCCGACGAGGCGGACCGGATCACCGGCCTGGAGGTCGGCGCCGACGACTACGTGACCAAACCGTTCTCCCCGCGGGA
GCTGACCCTGCGGGTGCGGTCGGTGCTGCGGCGGGCGGCCGAAGCCGCCGCGGCCCCGGAGCCCGGCGTCCTGCGGGCCG
GCGCCCTGGTCGTCGACCCGGCGGCGCGGACCGCGACCCGCCACGAGGTGCCACTCGGGCTCACCGTCCGCGAGTTCGAC
CTGCTGGCCTTCCTGCTGCGCCGGCCCGGCCACGCCTTCACCCGGGTCGAGCTGCTCGAACAGGTGTGGGGTTGGAGCTA
CGGCGACCCGTCGACGGTGACCGTGCACATCCGCCGGCTACGGGAGAAGATCGAGGACGATCCGACCGCCCCCCGCCTGC
TCGTCACCGTGTGGGGCGTTGGCTACCGCTACGACGCCCCGCCGGCGGTGGCCGGAGCGGAGGCGTCGCCGGGCGACCCA
CGGCAGGCGGGATGA

Protein sequence :
MARVLVVDDDALVAEVVDRYLRNAGFDVDRAADGPSALRTAEARPPDLVVLDLMLPGLDGLEVFRRLTARRPVPVIMLTA
RADEADRITGLEVGADDYVTKPFSPRELTLRVRSVLRRAAEAAAAPEPGVLRAGALVVDPAARTATRHEVPLGLTVREFD
LLAFLLRRPGHAFTRVELLEQVWGWSYGDPSTVTVHIRRLREKIEDDPTAPRLLVTVWGVGYRYDAPPAVAGAEASPGDP
RQAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-21 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system BAC0083 Protein 1e-26 47
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system NC_012469.1.7685629. Protein 5e-28 46
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system BAC0197 Protein 6e-25 45
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system NC_002952.2859905.p0 Protein 2e-30 44
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system NC_009641.5332272.p0 Protein 2e-30 44
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system NC_013450.8614421.p0 Protein 2e-30 44
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system NC_007622.3794472.p0 Protein 2e-30 44
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system NC_007793.3914279.p0 Protein 2e-30 44
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system NC_002758.1121668.p0 Protein 2e-30 44
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system NC_003923.1003749.p0 Protein 2e-30 44
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system NC_009782.5559369.p0 Protein 2e-30 44
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system NC_002951.3237708.p0 Protein 2e-30 44
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system NC_002745.1124361.p0 Protein 2e-30 44
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system AE000516.2.gene3505. Protein 1e-27 44
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system NC_012469.1.7686381. Protein 7e-29 43
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system BAC0638 Protein 1e-16 42
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system BAC0125 Protein 5e-23 42
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system HE999704.1.gene2815. Protein 5e-28 42
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system CP000034.1.gene3671. Protein 5e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system VFG1389 Protein 2e-24 46
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system VFG0596 Protein 5e-22 43
FRAAL1628 YP_711872.1 response regulator in two-component regulatory system VFG1390 Protein 4e-21 42