Gene Information

Name : RHA1_ro08012 (RHA1_ro08012)
Accession : YP_707217.1
Strain :
Genome accession: NC_008269
Putative virulence/resistance : Virulence
Product : response regulator, two-component system
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 9574 - 10251 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
ATGCGGCTACTTGTGGTCGAGGACGAGCGGCGCCTGGCCGCCGGGCTGCGCAAGGGGCTCGAGGCGGAAGGTTTTGCTGT
CGATGTCGTGCACAACGGCACCGACGGCCTCTGGATGGCGCGCGAGAACCCGTTCGATGCGATCGTTCTCGACATCATGT
TGCCCGGGGCGAACGGTTACCAGGTGTGCCGAACCTTGCGCAACGAGGGCAATTGGACCCCGATCCTGATGCTCACCGCC
AAGGTCGGGATCTGGGACGAGGTGGAGGGCCTCGACACCGGCGCCGACGACTACCTGGCCAAGCCGTTCTCGTACGCGGT
GCTGCTCGCCCGGCTGCGGGCGCTGCTGCGCCGGGGCGCGAGGCCGCGTCCCACCGTGCTCGAGGTCGGGGACCTGCGGT
TGGATCCGTCGGCCCGCCGGGTGTGGCGCCGCGGGGAGCAGATCGATTTGACGACACGTGAGTTCGCGGTCCTGGAGTTC
CTGCTGCGCCATCCCGGCGAGGTGCTGCCAAAGACGGACATCCTGGGCCACGTCTGGGACTTCGACTTCGACGGTGACCC
GAACATCGTGGAGGTCTACGTGCGGCGGCTGCGCACCAAGCTGGGGCGGCCGACGGATCCGCCGGTGATCGAAACCGTTC
GTGGAGCCGGATATCGGCTGGTCGCCCATGCTGACTGA

Protein sequence :
MRLLVVEDERRLAAGLRKGLEAEGFAVDVVHNGTDGLWMARENPFDAIVLDIMLPGANGYQVCRTLRNEGNWTPILMLTA
KVGIWDEVEGLDTGADDYLAKPFSYAVLLARLRALLRRGARPRPTVLEVGDLRLDPSARRVWRRGEQIDLTTREFAVLEF
LLRHPGEVLPKTDILGHVWDFDFDGDPNIVEVYVRRLRTKLGRPTDPPVIETVRGAGYRLVAHAD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-34 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RHA1_ro08012 YP_707217.1 response regulator, two-component system BAC0125 Protein 3e-42 50
RHA1_ro08012 YP_707217.1 response regulator, two-component system BAC0111 Protein 5e-43 47
RHA1_ro08012 YP_707217.1 response regulator, two-component system BAC0308 Protein 2e-39 46
RHA1_ro08012 YP_707217.1 response regulator, two-component system BAC0197 Protein 1e-37 46
RHA1_ro08012 YP_707217.1 response regulator, two-component system BAC0638 Protein 1e-31 46
RHA1_ro08012 YP_707217.1 response regulator, two-component system BAC0083 Protein 1e-39 45
RHA1_ro08012 YP_707217.1 response regulator, two-component system AE000516.2.gene3505. Protein 4e-36 45
RHA1_ro08012 YP_707217.1 response regulator, two-component system Y16952.3.orf35.gene. Protein 3e-27 44
RHA1_ro08012 YP_707217.1 response regulator, two-component system BAC0347 Protein 8e-36 43
RHA1_ro08012 YP_707217.1 response regulator, two-component system U82965.2.orf14.gene. Protein 1e-27 43
RHA1_ro08012 YP_707217.1 response regulator, two-component system NC_002516.2.879194.p Protein 7e-28 42
RHA1_ro08012 YP_707217.1 response regulator, two-component system BAC0288 Protein 7e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RHA1_ro08012 YP_707217.1 response regulator, two-component system VFG1390 Protein 7e-39 43
RHA1_ro08012 YP_707217.1 response regulator, two-component system VFG1389 Protein 3e-31 42
RHA1_ro08012 YP_707217.1 response regulator, two-component system VFG0596 Protein 7e-35 41