Gene Information

Name : mtrA (RHA1_ro06324)
Accession : YP_706259.1
Strain : Rhodococcus jostii RHA1
Genome accession: NC_008268
Putative virulence/resistance : Virulence
Product : response regulator, two-component system
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6814693 - 6815370 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGAAGCCAAGGATTCTGGTTGTCGACGACGACACTGCGCTCGCGGAGATGCTCACGATCGTCCTCCGCGGCGAAGGATT
CGATCCGTATGTGGTGGGGGACGGGACCCAGGCGCTCACCGCGGTCCGGGAGACACGCCCGGACCTGGTGCTGCTCGACC
TGATGCTGCCCGGCATGAACGGCATCGACGTGTGCCGCGTCCTGCGGGCCGATTCCGGTGTCCCCATCGTGATGCTGACC
GCCAAGACGGACACCGTCGACGTGGTCCTCGGATTGGAATCCGGCGCGGACGACTACATCATGAAGCCGTTCAAGCCGAA
GGAACTGGTGGCGCGGGTCCGGGCACGGCTTCGCCGGACCGAGGACGAGCCGGCCGAGCTGCTCAGCATCGCCGACATCG
TCATCGACGTCCCCGCCCACAAGGTGAGCCGGGGCGAAGAACTGATCTCCCTCACCCCCCTCGAGTTCGATCTCCTGGTG
GCTCTGGCGCGCAAACCGCGACAGGTGTTCACCCGTGAGGTCCTGCTCGAGCAGGTGTGGGGTTACCGACATGCAGCCGA
CACCCGACTGGTCAACGTGCACGTTCAGCGTCTGCGGGCCAAGGTCGAGACTGATCCCGAAAATCCCGAAGTGGTTTTGA
CGGTCAGGGGGGTCGGCTACAAGGCCGGACCGCCGTGA

Protein sequence :
MKPRILVVDDDTALAEMLTIVLRGEGFDPYVVGDGTQALTAVRETRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLT
AKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRRTEDEPAELLSIADIVIDVPAHKVSRGEELISLTPLEFDLLV
ALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRAKVETDPENPEVVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-33 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_706259.1 response regulator, two-component system AE000516.2.gene3505. Protein 2e-89 91
mtrA YP_706259.1 response regulator, two-component system NC_002952.2859905.p0 Protein 8e-43 46
mtrA YP_706259.1 response regulator, two-component system NC_009782.5559369.p0 Protein 1e-42 46
mtrA YP_706259.1 response regulator, two-component system NC_002951.3237708.p0 Protein 1e-42 46
mtrA YP_706259.1 response regulator, two-component system NC_003923.1003749.p0 Protein 1e-42 46
mtrA YP_706259.1 response regulator, two-component system NC_002758.1121668.p0 Protein 1e-42 46
mtrA YP_706259.1 response regulator, two-component system NC_009641.5332272.p0 Protein 1e-42 46
mtrA YP_706259.1 response regulator, two-component system NC_013450.8614421.p0 Protein 1e-42 46
mtrA YP_706259.1 response regulator, two-component system NC_007793.3914279.p0 Protein 1e-42 46
mtrA YP_706259.1 response regulator, two-component system NC_007622.3794472.p0 Protein 8e-43 46
mtrA YP_706259.1 response regulator, two-component system NC_002745.1124361.p0 Protein 1e-42 46
mtrA YP_706259.1 response regulator, two-component system NC_012469.1.7686381. Protein 9e-39 45
mtrA YP_706259.1 response regulator, two-component system NC_012469.1.7685629. Protein 2e-36 45
mtrA YP_706259.1 response regulator, two-component system BAC0125 Protein 2e-30 44
mtrA YP_706259.1 response regulator, two-component system CP001918.1.gene3444. Protein 2e-37 44
mtrA YP_706259.1 response regulator, two-component system HE999704.1.gene2815. Protein 3e-38 43
mtrA YP_706259.1 response regulator, two-component system BAC0347 Protein 2e-22 42
mtrA YP_706259.1 response regulator, two-component system AE015929.1.gene1106. Protein 6e-29 42
mtrA YP_706259.1 response regulator, two-component system FJ349556.1.orf0.gene Protein 9e-32 42
mtrA YP_706259.1 response regulator, two-component system CP000034.1.gene2186. Protein 9e-37 42
mtrA YP_706259.1 response regulator, two-component system NC_002695.1.916589.p Protein 6e-37 42
mtrA YP_706259.1 response regulator, two-component system CP000647.1.gene2531. Protein 1e-36 42
mtrA YP_706259.1 response regulator, two-component system BAC0039 Protein 9e-37 42
mtrA YP_706259.1 response regulator, two-component system BAC0111 Protein 6e-26 41
mtrA YP_706259.1 response regulator, two-component system CP000675.2.gene1535. Protein 1e-30 41
mtrA YP_706259.1 response regulator, two-component system HE999704.1.gene1528. Protein 6e-35 41
mtrA YP_706259.1 response regulator, two-component system BAC0197 Protein 8e-27 41
mtrA YP_706259.1 response regulator, two-component system BAC0596 Protein 3e-35 41
mtrA YP_706259.1 response regulator, two-component system CP001138.1.gene2239. Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_706259.1 response regulator, two-component system VFG1390 Protein 2e-32 44
mtrA YP_706259.1 response regulator, two-component system VFG1389 Protein 1e-26 42
mtrA YP_706259.1 response regulator, two-component system VFG1563 Protein 7e-34 41
mtrA YP_706259.1 response regulator, two-component system VFG1702 Protein 1e-33 41