Gene Information

Name : RHA1_ro01679 (RHA1_ro01679)
Accession : YP_701650.1
Strain : Rhodococcus jostii RHA1
Genome accession: NC_008268
Putative virulence/resistance : Resistance
Product : tellerium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1769710 - 1770285 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGGCGTCACTCTGGCCAAAGGCGGCAATGTTTCCCTGTCGAAGGCGGCACCGAACCTGACAACGGTGTCGGTCGGACT
CGGCTGGGATGCACGCAGCACAACCGGCGCACCCTTCGACCTAGACGCGAGCGCCCTTGCCACCGGTCAAGACCGCAAGG
TGCTCTCCGACCTGCACTTCGTGTTCTACAACAACCTCCGCTCCCCCGACGGTTCGATCGAGCACACTGGCGACAACCTC
ACCGGCGAGGGAGATGGCGATGACGAATCGATCAACGTCGACCTGTCCGCCGTTCCGCCGAACGTCACAAACATTTTCTT
CCCGGTCTCCATCCACGACGCCGACACCCGCGGCCAGTCCTTCGGGCAGGTCACCAACGCCTTCATCCGCGTCGTCGACA
GCACCACCGGAATAGAACTTGCGCGCTACGACCTCACCGAAGATGCGTCCAGCGAAACCGCCATGCTCTTCGGCGAGGTC
TACCGCCACAACGGGGAATGGAAGTTCCGCGCAATCGGGCAGGGCTACGCCTCCGGACTCGCCGGCATCGCACGCGACTA
CGGCGTTAATATCTGA

Protein sequence :
MGVTLAKGGNVSLSKAAPNLTTVSVGLGWDARSTTGAPFDLDASALATGQDRKVLSDLHFVFYNNLRSPDGSIEHTGDNL
TGEGDGDDESINVDLSAVPPNVTNIFFPVSIHDADTRGQSFGQVTNAFIRVVDSTTGIELARYDLTEDASSETAMLFGEV
YRHNGEWKFRAIGQGYASGLAGIARDYGVNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-58 67
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-59 67
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-59 67
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-58 63
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-55 62
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 6e-56 59
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-56 59
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-56 59
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-25 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-25 43
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RHA1_ro01679 YP_701650.1 tellerium resistance protein BAC0389 Protein 2e-58 66
RHA1_ro01679 YP_701650.1 tellerium resistance protein BAC0390 Protein 2e-58 60
RHA1_ro01679 YP_701650.1 tellerium resistance protein BAC0392 Protein 2e-25 43