Gene Information

Name : SFV_4227 (SFV_4227)
Accession : YP_691515.1
Strain : Shigella flexneri 8401
Genome accession: NC_008258
Putative virulence/resistance : Unknown
Product : P4-type integrase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 4363338 - 4364531 bp
Length : 1194 bp
Strand : -
Note : Code: L; COG: COG0582

DNA sequence :
ATGGCTCTGAGTGATGTGAAGGTTCGTTCGGCTAAGCCTGAAGCAAAAGCCTATAAGCTGACCGACGGTGAAGGCATGGT
TTTGCTGGTTCACCCTAACGGCTCCAAATACTGGCGGCTACGTTATCGCTTTGACGGCAAAGAGAAGATGCTGGCATTGG
GGAAATACCCCGAAGTGTCGTTGGCGGATGCCAGGGCACGCCGGGATGAGGCTCGTAAGCTTTTAGCTAATGGTGTCGAT
CCCAGTGAAAACAAGAAAGCTGTTAAGGTAGAACAGGAACAAGAGGCGATAACGTTTGAAGTAGTCGCCAGAGACTGGCA
CGCCAGCAATCAGAAGTGGTCGGCATCGCATAGCGCTCGTGTTTTGAAAAGTCTGGAGGATAATCTCTTTACTGCTATCG
GTAAGCGGAACATTGCGGAACTGAAGACGCGGGATCTTCTTGTACCCATTAAAGCAGTCGAGTCATCCGGGCGGCTCGAA
GTTGCCGCCCGTTTACAGCAGCGTACTACCGCGATTATGCGCTTTGCCGTTCAGAGCGGCTTAATCGACTACAACCCCGC
GCAAGAGATTGCAGGTGCGGTTGCTACGGCGAAAAGACAGCACCGTGCAGCTCTTGAACTGAACCGTATACCTGAATTAC
TTCATCGCATAGATCACTATTCTGGCAGACCGTTAACTCGACTGGCGGTTGAACTCACTTTATTGGTTTTCATCCGTTCG
AGCGAGCTGCGTTTTGCCCGCTGGTCAGAAATAGATTTTGAAACGGCTATGTGGACAATCCCAGGTGAGCGTGAGCAACT
GGAAGGAGTCAAGCATTCTCAGCGTGGCTCGAAGATGCGGACACCACACCTTGTACCTTTGTCGCGGCAGGCCCTAAGTA
TTTTGGAAAAGATCAAAAGCATGAGCGGAAATCGAGAGCTGATTTTTGTGGGCGATCACGATCCACGTAAGCCGATGAGT
GAGAATACGGTGAACAAGGCTTTGCGCGTAATGGGGTATGACACGAAGGTCGAGGTTTGTGGGCATGGCTTCAGGACGAT
GGCTTGTAGTTCGTTGATTGAGTCGGGATTATGGTCGAGGGATGCGGTAGAGCGGCAGATGAGTCACCAGGAGCGTAGCT
CTGTGCGAGCAGCTTACATCCATAAGGCGGAACATCTTGGGGAGCGTAGGTTGATGTTTGAAGTGGCACACTGA

Protein sequence :
MALSDVKVRSAKPEAKAYKLTDGEGMVLLVHPNGSKYWRLRYRFDGKEKMLALGKYPEVSLADARARRDEARKLLANGVD
PSENKKAVKVEQEQEAITFEVVARDWHASNQKWSASHSARVLKSLEDNLFTAIGKRNIAELKTRDLLVPIKAVESSGRLE
VAARLQQRTTAIMRFAVQSGLIDYNPAQEIAGAVATAKRQHRAALELNRIPELLHRIDHYSGRPLTRLAVELTLLVFIRS
SELRFARWSEIDFETAMWTIPGEREQLEGVKHSQRGSKMRTPHLVPLSRQALSILEKIKSMSGNRELIFVGDHDPRKPMS
ENTVNKALRVMGYDTKVEVCGHGFRTMACSSLIESGLWSRDAVERQMSHQERSSVRAAYIHKAEHLGERRLMFEVAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
intB CAD42017.1 bacteriophage P4 integrase Not tested PAI II 536 Protein 7e-139 80
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 9e-135 70
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 1e-132 70
int AAK16198.1 Int Not tested PAI-I AL862 Protein 1e-134 70
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 1e-134 70
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 3e-134 70
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 4e-134 69
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 8e-135 69
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 8e-135 69
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 2e-134 69
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 3e-134 69
int AAL51028.1 CP4-like integrase Not tested LEE Protein 1e-134 69
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 2e-134 69
int-phe AAL60261.1 Int-phe Not tested LEE Protein 1e-134 69
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 1e-134 69
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 9e-134 69
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 6e-134 69
int AAL51003.1 CP4-like integrase Not tested LEE Protein 3e-134 69
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 1e-134 69
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 2e-134 69
int AAK00456.1 Int Not tested SHI-1 Protein 5e-125 69
int CAC81896.1 integrase Not tested LEE II Protein 1e-124 69
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 2e-119 63
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 2e-119 63
STY4821 NP_458899.1 integrase Not tested SPI-10 Protein 2e-109 59
APECO1_1051 YP_853069.1 phage integrase Not tested PAI IV APEC-O1 Protein 4e-82 57
int YP_002346908.1 integrase Not tested HPI Protein 2e-100 56
y2393 NP_669700.1 prophage integrase Not tested HPI Protein 2e-100 56
int2 NP_993013.1 integrase Not tested HPI Protein 2e-100 56
int CAA08754.1 integrase Not tested HPI Protein 5e-101 56
int CAA21384.1 - Not tested HPI Protein 2e-100 56
int CAB59974.1 integrase Not tested HPI Protein 5e-102 56
intB AAD37509.1 P4-like integrase Not tested PAI IV 536 Protein 9e-87 56
int NP_807963.1 bacteriophage integrase Not tested SPI-7 Protein 6e-103 55
int NP_458759.1 bacteriophage integrase Not tested SPI-7 Protein 6e-103 55
unnamed AAD17660.1 unknown Not tested HPI Protein 2e-97 54
unnamed ABR13507.1 phage integrase Not tested PAGI-6 Protein 8e-98 54
int AAD44730.1 Int Not tested SHI-2 Protein 9e-79 43
int CAC39282.1 integrase Not tested LPA Protein 2e-79 43
aec33 AAW51716.1 Int Not tested AGI-3 Protein 1e-79 43
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 2e-77 42
ECs4534 NP_312561.1 integrase Not tested LEE Protein 2e-77 42
int AAC31482.1 CP4-like integrase Not tested LEE Protein 1e-77 42
int ACU09430.1 integrase Not tested LEE Protein 1e-77 42
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 1e-77 42
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 2e-77 42
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 2e-77 42
ESA_03025 YP_001439090.1 hypothetical protein Not tested Not named Protein 8e-68 41
unnamed AFX83955.1 integrase Not tested SE-PAI Protein 4e-67 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SFV_4227 YP_691515.1 P4-type integrase VFG1536 Protein 4e-139 80
SFV_4227 YP_691515.1 P4-type integrase VFG1693 Protein 1e-134 70
SFV_4227 YP_691515.1 P4-type integrase VFG0626 Protein 3e-135 69
SFV_4227 YP_691515.1 P4-type integrase VFG0783 Protein 7e-78 42
SFV_4227 YP_691515.1 P4-type integrase VFG0598 Protein 7e-78 42