Gene Information

Name : ECP_3844 (ECP_3844)
Accession : YP_671716.1
Strain : Escherichia coli 536
Genome accession: NC_008253
Putative virulence/resistance : Unknown
Product : IS orf
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 4014160 - 4014429 bp
Length : 270 bp
Strand : -
Note : -

DNA sequence :
ATGATCCCGTTACCTTCCGGGACCAAAATTTGGCTGGTTGCCGGTATCACCGATATGAGAAATGGCTTCAACGGCCTGGC
TGCGAAAGTACAGACGGCGCTGAAAGACGATCCCATGTCCGGCCATGTTTTCATTTTCCGGGGCCGCAGCGGCAGTCAGG
TTAAACTGCTGTGGTCCACCGGTGACGGGCTGTGCCTCCTGACCAAACGGCTGGAGCGTGGGCGCTTCGCCTGGCCGTCA
GCCTGTGATGGCAAAGTGTTCCTTACGTAG

Protein sequence :
MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFIFRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPS
ACDGKVFLT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-37 100
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-36 99
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-36 99
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-36 99
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-36 99
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-36 99
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-36 99
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-36 99
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-36 99
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-35 98
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-35 98
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 7e-36 97
unnamed AAL08461.1 unknown Not tested SRL Protein 7e-36 97
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 7e-36 97
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-30 76
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-30 76
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 4e-30 75
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 5e-28 70
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 5e-28 70
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 8e-22 67
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-25 66
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-25 66
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-26 65
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-26 65
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-26 63

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECP_3844 YP_671716.1 IS orf VFG1517 Protein 2e-37 100
ECP_3844 YP_671716.1 IS orf VFG0792 Protein 1e-36 99
ECP_3844 YP_671716.1 IS orf VFG1709 Protein 1e-36 99
ECP_3844 YP_671716.1 IS orf VFG1698 Protein 2e-36 97
ECP_3844 YP_671716.1 IS orf VFG1052 Protein 3e-36 97
ECP_3844 YP_671716.1 IS orf VFG1665 Protein 2e-30 75
ECP_3844 YP_671716.1 IS orf VFG1737 Protein 5e-27 63