Gene Information

Name : ECP_2020 (ECP_2020)
Accession : YP_669920.1
Strain : Escherichia coli 536
Genome accession: NC_008253
Putative virulence/resistance : Virulence
Product : regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 2095269 - 2095475 bp
Length : 207 bp
Strand : +
Note : -

DNA sequence :
ATGGCTACCCCAGTTTCGCTGATGGATGACCAGATGGTCGACATGGCGTTTATCACTCAACTGACCGGCTTAACCGATAA
GTGGTTTTACAAACTCATCAAAGTTGGGGGCTTTCCTGCCCCCATCAAAATGGGGCGCAGCTCCCGCTGGCTGAAAAGTG
AAGTGGAAGCCTGGCTGCAGGCGCGTATTGCACAGTCCCGTCCGTAA

Protein sequence :
MATPVSLMDDQMVDMAFITQLTGLTDKWFYKLIKVGGFPAPIKMGRSSRWLKSEVEAWLQARIAQSRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 1e-25 96
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 1e-25 96
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 7e-26 95
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 2e-25 93
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 1e-25 92
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 2e-25 92
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 2e-25 92
unnamed AAL08466.1 unknown Not tested SRL Protein 2e-25 92
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 8e-14 68
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 8e-14 68
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-17 68
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 4e-17 68

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECP_2020 YP_669920.1 regulatory protein VFG0651 Protein 5e-26 92
ECP_2020 YP_669920.1 regulatory protein VFG1057 Protein 1e-25 92
ECP_2020 YP_669920.1 regulatory protein VFG1480 Protein 2e-17 68