Gene Information

Name : ureA (RD1_3793)
Accession : YP_683947.1
Strain : Roseobacter denitrificans OCh 114
Genome accession: NC_008209
Putative virulence/resistance : Virulence
Product : urease subunit gamma
Function : -
COG functional category : E : Amino acid transport and metabolism
COG ID : COG0831
EC number : 3.5.1.5
Position : 3671993 - 3672295 bp
Length : 303 bp
Strand : +
Note : UreA, with UreB and UreC catalyzes the hydrolysis of urea into ammonia and carbon dioxide; nickel metalloenzyme; accessory proteins UreD, UreE, UreF, and UreG are necessary for assembly of the metallocenter

DNA sequence :
ATGCAACTCACCCCACGGGAAAAAGACAAACTGCTCATTTCGATGGCCGCCGAAGTTGCCCGCAAAAGGCTCGCGCGCGG
GGTCAAGCTGAACCACCCCGAGGCCATAGCGCTGATCACGGATGCGGTTGTGGAGGGCGCACGCGATGGGCGGTCCGTTG
CCGATATGATGGAAGCCGGCGCCCAGGTGATCACGCGCGACCAATGCATGGAAGGGGTGCCGGAGATGATCCACGATGTG
CAGGTCGAGGCGACCTTTCCCGATGGCACCAAACTTGTCACCGTCCACAACCCGATCCGCTAG

Protein sequence :
MQLTPREKDKLLISMAAEVARKRLARGVKLNHPEAIALITDAVVEGARDGRSVADMMEAGAQVITRDQCMEGVPEMIHDV
QVEATFPDGTKLVTVHNPIR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ureA YP_003784327.1 urease subunit gamma Not tested PiCp 7 Protein 5e-31 69
ureA YP_005686360.1 urease subunit gamma Not tested PiCp 7 Protein 5e-31 69
ureA YP_005682176.1 urease subunit gamma Not tested PiCp 7 Protein 5e-31 69
ureA YP_005684268.1 urease subunit gamma Not tested PiCp 7 Protein 5e-31 69
ureA NP_286678.1 urease subunit gamma Virulence TAI Protein 7e-28 69
ureA NP_287086.1 urease subunit gamma Not tested TAI Protein 7e-28 69