
|
Name : YPA_0571 (YPA_0571) Accession : YP_650484.1 Strain : Yersinia pestis Antiqua Genome accession: NC_008150 Putative virulence/resistance : Virulence Product : transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 655055 - 655255 bp Length : 201 bp Strand : - Note : - DNA sequence : ATGTCTGATATTAATTTGATCCGCTTACCTGAAGTGATTGAGAAAATACGACTGAAAAAATCATCAATTTATCATTTGAT TAGCCTCAATCAATTCCCTCGCCCAATAAAATTAGGGCCGCGTTCAGTGGCCTGGGTTGAAAGTGAAGTCGATGAATGGG TCATTATCAGAATCAATCAACGCGAGGAGGGTCGCAACTAA Protein sequence : MSDINLIRLPEVIEKIRLKKSSIYHLISLNQFPRPIKLGPRSVAWVESEVDEWVIIRINQREEGRN |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-11 | 50 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-11 | 50 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 3e-11 | 50 |
| PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 1e-09 | 49 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 1e-10 | 48 |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 7e-11 | 48 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 5e-10 | 45 |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-10 | 45 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 5e-10 | 45 |
| Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 2e-04 | 41 |
| Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 2e-04 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| YPA_0571 | YP_650484.1 | transcriptional regulator | VFG1141 | Protein | 1e-11 | 50 |
| YPA_0571 | YP_650484.1 | transcriptional regulator | VFG1118 | Protein | 2e-10 | 45 |