Gene Information

Name : rpsN (YPN_3846)
Accession : YP_649773.1
Strain : Yersinia pestis Nepal516
Genome accession: NC_008149
Putative virulence/resistance : Unknown
Product : 30S ribosomal protein S14
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG0199
EC number : -
Position : 4391889 - 4392194 bp
Length : 306 bp
Strand : -
Note : located in the peptidyl transferase center and involved in assembly of 30S ribosome subunit; similar to what is observed with proteins L31 and L33, some proteins in this family contain CXXC motifs that are involved in zinc binding; if two copies are prese

DNA sequence :
ATGGCTAAGCAATCAATGAAAGCACGCGAAGTTGTTCGCGTGAAACTAGCTAACAAATACCGCGCTAAACGCGAGGAATT
AAAAGCTATTATCTCTGGTGTGAACTCATCCGACGAAGATCGTTGGGATGCTGTTCTGAAGCTGCAGTCTCTGCCGCGTG
ATTCCAGCCCGTCCCGTCAGCGTAACCGCTGCAACCAAACTGGTCGTCCTCATGGTTTCCTGCGGAAGTTCGGGTTGAGC
CGTATTAAAGTCCGTGAAACCGCTATGCGCGGTGAAATCCCGGGCCTTAAGAAGGCTAGCTGGTAA

Protein sequence :
MAKQSMKAREVVRVKLANKYRAKREELKAIISGVNSSDEDRWDAVLKLQSLPRDSSPSRQRNRCNQTGRPHGFLRKFGLS
RIKVRETAMRGEIPGLKKASW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpsN NP_814350.1 30S ribosomal protein S14 Not tested Not named Protein 4e-12 49
ef0103 AAM75306.1 EF0103 Not tested Not named Protein 3e-12 49