Gene Information

Name : Rxyl_0378 (Rxyl_0378)
Accession : YP_643166.1
Strain : Rubrobacter xylanophilus DSM 9941
Genome accession: NC_008148
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 406295 - 406999 bp
Length : 705 bp
Strand : -
Note : PFAM: response regulator receiver transcriptional regulatory protein-like; KEGG: ctc:CTC01130 transcriptional regulatory protein

DNA sequence :
ATGGCTAGGGTGCTCATAGTAGAGGACGACCCGGCGGTGCGCGACGTGGTGGAGCACACCCTGTCCCGCGAGGGCATCGA
GACCGAGACCGTCCCCGACGGGGAGACGGCGCTGGAGCTGCTCTCGGACTCCAAGCCCTTCGACCTGGTGCTGCTCGACG
TCATGCTGCCGGGGATGGACGGCATCTCGGTCTGCCGGGAGCTCAGGGAGAGCCACTCCCCGCACCGCACCGTCCCGGTG
GTGATGCTCACCGCCCGCGACGACGAGACGAGCATCGTGGTGGGGCTGGAGGTGGGGGCCGACGACTACATCACCAAGCC
CTTCAGCCCCCGGCAGCTCGCCAGCAGGGTGCGGGCGCAGCTCAGGCGGCAGCGGATGAACGCCCAGGCCTCCCCCGAGC
AGCGCAAGCTGGAGTTCCCCGGGCTGGAGATAGACCTCCTGCGCCGGAGGGTCACGGCGCGGGGGGAGCAGGTCGAGCTC
ACCGCCCGCGAGTTCGAGGTGCTGGCGCTTCTGGCCTCCAACCCGGGCCGGGTCTACAGCCGGGAGCAGATAATGGACCA
CCTGTGGGGCGGGGAGTTCTTCGGGGAGCCCCGCTCGGCGGACGTCCACATCCAGCACCTCCGCCAGAAGATCGAGCCGG
ACCCGAAGAACCCGCGCTACATCCAGACGGTGCGGGGCATGGGCTACCGGTTCGCCGAGCTCTAG

Protein sequence :
MARVLIVEDDPAVRDVVEHTLSREGIETETVPDGETALELLSDSKPFDLVLLDVMLPGMDGISVCRELRESHSPHRTVPV
VMLTARDDETSIVVGLEVGADDYITKPFSPRQLASRVRAQLRRQRMNAQASPEQRKLEFPGLEIDLLRRRVTARGEQVEL
TAREFEVLALLASNPGRVYSREQIMDHLWGGEFFGEPRSADVHIQHLRQKIEPDPKNPRYIQTVRGMGYRFAEL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rxyl_0378 YP_643166.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-41 44
Rxyl_0378 YP_643166.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 6e-47 43
Rxyl_0378 YP_643166.1 two component transcriptional regulator BAC0197 Protein 4e-35 43
Rxyl_0378 YP_643166.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-43 43
Rxyl_0378 YP_643166.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-43 43
Rxyl_0378 YP_643166.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-43 43
Rxyl_0378 YP_643166.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-43 43
Rxyl_0378 YP_643166.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-43 43
Rxyl_0378 YP_643166.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-43 43
Rxyl_0378 YP_643166.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-43 43
Rxyl_0378 YP_643166.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-43 43
Rxyl_0378 YP_643166.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-43 43
Rxyl_0378 YP_643166.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-43 43
Rxyl_0378 YP_643166.1 two component transcriptional regulator NC_012469.1.7685629. Protein 6e-43 42
Rxyl_0378 YP_643166.1 two component transcriptional regulator HE999704.1.gene2815. Protein 3e-46 42
Rxyl_0378 YP_643166.1 two component transcriptional regulator CP000034.1.gene3671. Protein 3e-42 42
Rxyl_0378 YP_643166.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-31 41
Rxyl_0378 YP_643166.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-45 41
Rxyl_0378 YP_643166.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-45 41
Rxyl_0378 YP_643166.1 two component transcriptional regulator CP001918.1.gene5135. Protein 3e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rxyl_0378 YP_643166.1 two component transcriptional regulator VFG1563 Protein 3e-36 41