Gene Information

Name : Rxyl_0187 (Rxyl_0187)
Accession : YP_642977.1
Strain : Rubrobacter xylanophilus DSM 9941
Genome accession: NC_008148
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 189705 - 190388 bp
Length : 684 bp
Strand : +
Note : PFAM: response regulator receiver transcriptional regulatory protein-like; KEGG: gme:Gmet_3383 two component transcriptional regulator, winged helix family

DNA sequence : 
ATGAGGGTCCTGATCGTAGAGGACGAGCCGGGCATCGTCCGGATGCTGGAGCGCGGGCTCTCCGCCCAGGGCTACAGCTG
CCTGAGCGCCGAGGACGGCGAGACGGGTCTGCGGATGGCCCTGGAGGAGGACGTGGACGTGGTGCTGCTGGACATCATGC
TGCCCGGCCTCGACGGCCGGGAGGTGCTCCGGCGGCTGCGGCTGCGGCGCCCGGGGCTGCCGGTGCTGATGCTGACCGCC
CGCGACGAGGTGGAGACGAAGGTCGGCTCCCTGGACGCCGGCGCCGACGACTACCTCACCAAGCCCTTCGCCTTCGAGGA
GCTCCTCGCCCGCATCCGGGCGCTCGTGCGGCGGGCCGACCAGCCGGAGAGCACCGCCCTGCGGGCCGGGGACCTCAAGC
TGGACCTGCTCTCGCGCCGCGTCTGGCGCGCCGGGCGGCAGGTAGAGCTCTCGAGCCGCGAGTTCGCGCTGCTGGAGTAC
CTGATGCGCCATCCCCGGCAGGTGCTCAGCCGCCAGCAGATCCTCTCGGCGGTCTGGGACTACGCCTTCGACCCGGGCTC
TAACGTGGTGGACGTCTACGTCCGCTACCTGCGCCGCAAGCTGGACCGCCCCGGCGAGCCCTCCCTGATCACGACGGTCC
GGGGCGCCGGGTACCGCTTCGACCCTCCCCGGGAGGAGGCGTGA

Protein sequence : 
MRVLIVEDEPGIVRMLERGLSAQGYSCLSAEDGETGLRMALEEDVDVVLLDIMLPGLDGREVLRRLRLRRPGLPVLMLTA
RDEVETKVGSLDAGADDYLTKPFAFEELLARIRALVRRADQPESTALRAGDLKLDLLSRRVWRAGRQVELSSREFALLEY
LMRHPRQVLSRQQILSAVWDYAFDPGSNVVDVYVRYLRRKLDRPGEPSLITTVRGAGYRFDPPREEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-27 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-27 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rxyl_0187 YP_642977.1 two component transcriptional regulator BAC0125 Protein 1e-36 50
Rxyl_0187 YP_642977.1 two component transcriptional regulator BAC0197 Protein 2e-32 50
Rxyl_0187 YP_642977.1 two component transcriptional regulator BAC0083 Protein 2e-31 48
Rxyl_0187 YP_642977.1 two component transcriptional regulator BAC0638 Protein 7e-28 47
Rxyl_0187 YP_642977.1 two component transcriptional regulator BAC0111 Protein 1e-32 46
Rxyl_0187 YP_642977.1 two component transcriptional regulator BAC0308 Protein 2e-29 46
Rxyl_0187 YP_642977.1 two component transcriptional regulator BAC0347 Protein 4e-29 45
Rxyl_0187 YP_642977.1 two component transcriptional regulator HE999704.1.gene1528. Protein 4e-32 45
Rxyl_0187 YP_642977.1 two component transcriptional regulator AE015929.1.gene1106. Protein 8e-25 43
Rxyl_0187 YP_642977.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-27 42
Rxyl_0187 YP_642977.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-27 42
Rxyl_0187 YP_642977.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-27 42
Rxyl_0187 YP_642977.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-27 42
Rxyl_0187 YP_642977.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-27 42
Rxyl_0187 YP_642977.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-27 42
Rxyl_0187 YP_642977.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-27 42
Rxyl_0187 YP_642977.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-27 42
Rxyl_0187 YP_642977.1 two component transcriptional regulator BAC0288 Protein 7e-19 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rxyl_0187 YP_642977.1 two component transcriptional regulator VFG1390 Protein 3e-36 51
Rxyl_0187 YP_642977.1 two component transcriptional regulator VFG1386 Protein 1e-33 45
Rxyl_0187 YP_642977.1 two component transcriptional regulator VFG1389 Protein 9e-33 45
Rxyl_0187 YP_642977.1 two component transcriptional regulator VFG0596 Protein 6e-28 44