Gene Information

Name : MXAN_5186 (MXAN_5186)
Accession : YP_633339.1
Strain : Myxococcus xanthus DK 1622
Genome accession: NC_008095
Putative virulence/resistance : Resistance
Product : small multidrug resistance (SMR) family protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 6479483 - 6479815 bp
Length : 333 bp
Strand : -
Note : identified by similarity to SP:Q57225; match to protein family HMM PF00893

DNA sequence :
ATGCACAACGCGGTCTATCTGGGGATTGCCATCGTGGCCGAGGTGGTGGCGACCTCAGCGCTCAAGAGCTCCAACGGCTT
CACGCGGCTGGGGCCGTCCATCCTCGTGGTGCTGGGCTATGGCGTGGCCTTCTTCTGCCTGTCCTTCGCGCTGAGGACCA
TCCCCACGGGCATCGCCTACGCCATCTGGTCCGGGGCGGGCATCGTCCTCGTCTCCGGCGTGGCGTGGCTCCTTCACGGG
CAGCGCTTGGACGTCCCCGCGCTCGTGGGCATCGGGCTCATCCTGGCGGGCGTCATCGTCATCAATACCTTCTCCAGGTC
GGCGGCGCACTGA

Protein sequence :
MHNAVYLGIAIVAEVVATSALKSSNGFTRLGPSILVVLGYGVAFFCLSFALRTIPTGIAYAIWSGAGIVLVSGVAWLLHG
QRLDVPALVGIGLILAGVIVINTFSRSAAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-22 61
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 9e-23 61
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 9e-23 61
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-23 61
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-22 61
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 9e-23 61
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 9e-23 61
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-23 61
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-22 61
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 9e-23 61
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 9e-23 61
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-23 61
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 9e-23 61
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 9e-23 61
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-23 61
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 9e-23 61
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 9e-23 61
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 9e-23 61
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-23 61
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 9e-23 61
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 9e-23 61
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-23 61
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-22 61
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 9e-23 61
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 9e-23 61
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 9e-23 61
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-22 61
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 9e-23 61
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 9e-23 61
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 9e-23 61
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 3e-10 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein BAC0324 Protein 1e-22 64
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein BAC0377 Protein 2e-17 61
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein BAC0322 Protein 4e-23 61
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein BAC0323 Protein 4e-23 61
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein CP001138.1.gene1489. Protein 1e-22 58
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein BAC0002 Protein 2e-19 57
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein NC_010410.6003348.p0 Protein 2e-19 57
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein NC_002695.1.913273.p Protein 3e-15 56
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein CP004022.1.gene1549. Protein 2e-15 56
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein BAC0150 Protein 3e-15 55
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein BAC0140 Protein 4e-09 44
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein BAC0477 Protein 3e-07 43
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein BAC0329 Protein 4e-11 43
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein BAC0216 Protein 4e-06 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MXAN_5186 YP_633339.1 small multidrug resistance (SMR) family protein VFG1586 Protein 1e-10 45