Gene Information

Name : MXAN_4117 (MXAN_4117)
Accession : YP_632295.1
Strain : Myxococcus xanthus DK 1622
Genome accession: NC_008095
Putative virulence/resistance : Unknown
Product : IS66 family transposase Orf1
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 5062491 - 5062856 bp
Length : 366 bp
Strand : -
Note : identified by match to protein family HMM PF05717

DNA sequence :
GTGTTTTCGCTGCCCGCGTCGGTGCGCGTGGTGCTGGCCACAACGCCGGTGGACATGCGCAAGTCGATAGACGGCCTCAT
GGCGCTGGTGCGCGCCGAGTGGGGCGAGGACGTCTACTCGGGGCACCTCTTCGCCTTCGTCTCGCGCAGGGGCGACAGAG
TCAAGGTGCTGACGTGGAGCCGAGGCGGCTTCGTGCTGCTGTACAAGCGGCTGGAGACGGGGAGATTCTGGCTGCCGCCG
GTGGACGCGGGTGCCCAGGTGGTGCACCTGGACGCCACGCAGTTGGCGATGCTGCTGGACGGCATCGACGTGGCCCAGGT
GAGGCGCCAGCCCGCCTGGACGCCTCCCGGGCGCACGGGCACCTGA

Protein sequence :
MFSLPASVRVVLATTPVDMRKSIDGLMALVRAEWGEDVYSGHLFAFVSRRGDRVKVLTWSRGGFVLLYKRLETGRFWLPP
VDAGAQVVHLDATQLAMLLDGIDVAQVRRQPAWTPPGRTGT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-15 48
unnamed AAL08461.1 unknown Not tested SRL Protein 8e-13 48
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-15 48
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-12 47
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 8e-12 47
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-12 47
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-12 47
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-12 47
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-12 47
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-12 47
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-12 47
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-12 47
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 8e-12 47
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 6e-13 47
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 6e-13 47
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 6e-15 47
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-12 46
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-12 46
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-12 46
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-12 46
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 9e-15 44
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-09 44
unnamed AAF71493.1 unknown Not tested Hrp PAI Protein 3e-13 44
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 8e-13 44
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 6e-13 41
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 6e-13 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MXAN_4117 YP_632295.1 IS66 family transposase Orf1 VFG1052 Protein 3e-13 48
MXAN_4117 YP_632295.1 IS66 family transposase Orf1 VFG1709 Protein 5e-13 47
MXAN_4117 YP_632295.1 IS66 family transposase Orf1 VFG0792 Protein 5e-13 47
MXAN_4117 YP_632295.1 IS66 family transposase Orf1 VFG1698 Protein 4e-13 46
MXAN_4117 YP_632295.1 IS66 family transposase Orf1 VFG1665 Protein 4e-15 44
MXAN_4117 YP_632295.1 IS66 family transposase Orf1 VFG1517 Protein 4e-10 44
MXAN_4117 YP_632295.1 IS66 family transposase Orf1 VFG1737 Protein 2e-13 44