Gene Information

Name : Bcen_4076 (Bcen_4076)
Accession : YP_623938.1
Strain :
Genome accession: NC_008061
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1251657 - 1252352 bp
Length : 696 bp
Strand : +
Note : TIGRFAM: Heavy metal response regulator; PFAM: response regulator receiver; KEGG: bur:Bcep18194_B1729 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
ATGAAAGTACTGATCGTCGAGGACGAACCGAAAGTCGTCGAATACCTGAAGAGCGGCCTGACCGAGGAAGGCTGGGTCGT
CGATACCGCGCTCGATGGCGAGGACGGCGCGTGGAAAGCCGTCGAATTCGACTACGACGTGGTCGTGCTCGACGTGATGC
TGCCGAAGCTCGACGGCTTCGGCGTGCTGCGTGCATTGCGCGCGCAGAAGCAGACTCCCGTGATCATGCTGACCGCGCGC
GATCGCGTCGACGACCGCGTGCGGGGCTTGCGCGGCGGCGCCGACGACTACCTGACCAAGCCCTTCTCGTTCCTCGAACT
GATCGAACGGCTGCGTGCGCTGACGCGCCGCGCCCGCGTGCAGGAATCGACGCTGATTTCGATCGGCGACCTGCGCGTCG
ACCTGATCGGCCGCCGCGCGACCCGCGACGGCGCGCGGCTCGACCTGACCGCGCAGGAATTCCAGCTGCTCGGCGTGCTC
GCGCGGCGCAGCGGCGAGGTGCTGTCGAAGACGACCATTGCCGAGCTCGTGTGGGACGTGAACTTCGACAGCAATGCGAA
CGTCGTCGAGACGGCGATCAAGCGCCTGCGCGCGAAACTCGATGGCCCCTTCGCGGAGAAGCTGCTGCACACGATCCGCG
GGATGGGCTACGTGCTCGAGGCGCGCGAGGACGGCGACACGGAGCGGCGCGCATGA

Protein sequence :
MKVLIVEDEPKVVEYLKSGLTEEGWVVDTALDGEDGAWKAVEFDYDVVVLDVMLPKLDGFGVLRALRAQKQTPVIMLTAR
DRVDDRVRGLRGGADDYLTKPFSFLELIERLRALTRRARVQESTLISIGDLRVDLIGRRATRDGARLDLTAQEFQLLGVL
ARRSGEVLSKTTIAELVWDVNFDSNANVVETAIKRLRAKLDGPFAEKLLHTIRGMGYVLEAREDGDTERRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-41 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-40 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcen_4076 YP_623938.1 two component heavy metal response transcriptional regulator BAC0083 Protein 4e-48 58
Bcen_4076 YP_623938.1 two component heavy metal response transcriptional regulator BAC0125 Protein 1e-52 57
Bcen_4076 YP_623938.1 two component heavy metal response transcriptional regulator BAC0638 Protein 7e-39 55
Bcen_4076 YP_623938.1 two component heavy metal response transcriptional regulator BAC0197 Protein 2e-47 54
Bcen_4076 YP_623938.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-45 51
Bcen_4076 YP_623938.1 two component heavy metal response transcriptional regulator BAC0111 Protein 3e-45 50
Bcen_4076 YP_623938.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-40 48
Bcen_4076 YP_623938.1 two component heavy metal response transcriptional regulator CP000675.2.gene1535. Protein 6e-30 41
Bcen_4076 YP_623938.1 two component heavy metal response transcriptional regulator CP001918.1.gene5135. Protein 1e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcen_4076 YP_623938.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-41 53
Bcen_4076 YP_623938.1 two component heavy metal response transcriptional regulator VFG1389 Protein 4e-31 48
Bcen_4076 YP_623938.1 two component heavy metal response transcriptional regulator VFG1386 Protein 3e-26 42