Gene Information

Name : Ldb0688 (Ldb0688)
Accession : YP_618756.1
Strain : Lactobacillus delbrueckii ATCC 11842
Genome accession: NC_008054
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 582180 - 582905 bp
Length : 726 bp
Strand : +
Note : -

DNA sequence :
ATGAAGATCTTAATGGTAGAAGATGACAAGTCAGTTTCACAAATGATGGAATTGTTCTTCAAGAAGGAAGGCTGGGAACA
AGTTTCCGCCTACGACGGTGAAGAAGCAGTCGAAATTTTCCAAACTCACCCGCGGGATTTTGACATCATCACTTTGGACT
TGAACCTGCCAAAGAAGGACGGGATTCAAGTGGCCAAGGAGATCCGCCGGATTTCTGAGACTGTGCCGATTATTATGCTG
ACGGCCCGCGACAGCGAATCTGACCAGGTTCTCGGCCTGGGTGTCGGGGCTGATGACTACGTAACCAAGCCATTCAGCCC
GATCGCCTTGATCGCCAGAATCAAGGCCCTGCACCGGCGGGTAATGCTGGAAGGGCAGCCAAGAAACCTGCCGAAGAACA
TCCCAAGCAACGACTTCGACTTGGAAACCAACCACATCCGGATCTCCAAGAGCCGGCGGGAAGTTTACTTTGACGAAAAC
CGGGTTGAAGGCTTGACGCCAAAGGAATTCGACCTGCTCTACACTATGGCCCAGAAGCCAAAGCAGGTCTTCTCCCGGGA
ACAGCTCCTGGAACTTGTCTGGGGCTATGAATACTTCGGTGAAGAAAGAACTGTTGACGCCCACATCAAGAAGCTGCGCC
AGAAGCTGGAAAAGTCTGGCCCGCAGATTATTCAAACCGTCTGGGGCGTGGGCTACAAGTTTGACGATTCACAGGTTAAC
GCATGA

Protein sequence :
MKILMVEDDKSVSQMMELFFKKEGWEQVSAYDGEEAVEIFQTHPRDFDIITLDLNLPKKDGIQVAKEIRRISETVPIIML
TARDSESDQVLGLGVGADDYVTKPFSPIALIARIKALHRRVMLEGQPRNLPKNIPSNDFDLETNHIRISKSRREVYFDEN
RVEGLTPKEFDLLYTMAQKPKQVFSREQLLELVWGYEYFGEERTVDAHIKKLRQKLEKSGPQIIQTVWGVGYKFDDSQVN
A

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-37 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-37 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ldb0688 YP_618756.1 two-component system response regulator NC_012469.1.7685629. Protein 7e-43 47
Ldb0688 YP_618756.1 two-component system response regulator CP001918.1.gene5135. Protein 5e-25 45
Ldb0688 YP_618756.1 two-component system response regulator NC_002952.2859905.p0 Protein 3e-42 44
Ldb0688 YP_618756.1 two-component system response regulator NC_002745.1124361.p0 Protein 2e-42 44
Ldb0688 YP_618756.1 two-component system response regulator NC_009782.5559369.p0 Protein 2e-42 44
Ldb0688 YP_618756.1 two-component system response regulator NC_002951.3237708.p0 Protein 2e-42 44
Ldb0688 YP_618756.1 two-component system response regulator NC_007622.3794472.p0 Protein 3e-42 44
Ldb0688 YP_618756.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-42 44
Ldb0688 YP_618756.1 two-component system response regulator NC_002758.1121668.p0 Protein 2e-42 44
Ldb0688 YP_618756.1 two-component system response regulator NC_009641.5332272.p0 Protein 2e-42 44
Ldb0688 YP_618756.1 two-component system response regulator NC_013450.8614421.p0 Protein 2e-42 44
Ldb0688 YP_618756.1 two-component system response regulator NC_007793.3914279.p0 Protein 2e-42 44
Ldb0688 YP_618756.1 two-component system response regulator HE999704.1.gene2815. Protein 6e-41 43
Ldb0688 YP_618756.1 two-component system response regulator FJ349556.1.orf0.gene Protein 1e-41 41
Ldb0688 YP_618756.1 two-component system response regulator NC_012469.1.7686381. Protein 3e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ldb0688 YP_618756.1 two-component system response regulator VFG1563 Protein 7e-38 42
Ldb0688 YP_618756.1 two-component system response regulator VFG1702 Protein 1e-37 42