Gene Information

Name : Sala_0626 (Sala_0626)
Accession : YP_615680.1
Strain : Sphingopyxis alaskensis RB2256
Genome accession: NC_008048
Putative virulence/resistance : Resistance
Product : gentamicin 3'-N-acetyltransferase
Function : -
COG functional category : R : General function prediction only
COG ID : COG0456
EC number : -
Position : 638262 - 638720 bp
Length : 459 bp
Strand : -
Note : -

DNA sequence :
ATGATCGTCCGCCGCCTCGGCCCCGGCGACATCGCCGCAGTGCGCGCGCTGAACGCGGTCTATGGCGCCGCCTTCGACGA
CCCCGAAACCTATCGCGCCGACCGTCCCGACGACGCATGGCTGGCGCGCCAGCTTGGCCGCGAGGGGGTGATCGTGCTGG
TCGCCGAACTGGACGGCAACATCGTCGGCGGCCTCACCGCCTATGAGCTACCGAAGCTTGAGGCGGCGCGCAGCGAAATC
TATCTCTATGACCTCGCGGTCGATGCCGCGCACCGCCGCTGCGGTATCGCCACCGCGCTGATCGGGGAGCTTCAACATAT
CGCCGCCGAAACCGGCGCCTGGGCGGTGTTCGTCCAGGCCGACCATGGCGACGACCCCGCGGTTGCGTTATACACCGGGC
TCGGCGCGCGCGAGGATGTGATGCATTTCGACCTGCCCCCGCGACCGCGCGGCGCATAG

Protein sequence :
MIVRRLGPGDIAAVRALNAVYGAAFDDPETYRADRPDDAWLARQLGREGVIVLVAELDGNIVGGLTAYELPKLEAARSEI
YLYDLAVDAAHRRCGIATALIGELQHIAAETGAWAVFVQADHGDDPAVALYTGLGAREDVMHFDLPPRPRGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
acc(3)Ic ACY75521.1 Aac(3) Ic Not tested Tn6060 Protein 2e-35 54
aac3 CAJ77083.1 Aminoglycoside 3-acetyltransferase Not tested AbaR1 Protein 2e-32 54
aacC1/aacCA1 ACV89833.1 type A aminoglycoside-(3)-acetyltransferase AacC-A1 or AacC1 or AAC-(3)-Ia Not tested AbaR7 Protein 2e-32 54
aacC1 AFV53118.1 aminoglycoside (3) acetyltransferase AacC1 or AacC-A1 or AAC(3)-Ia Not tested AbGRI2-1 Protein 2e-32 54
aacC1 YP_005797146.1 aminoglycoside N(3')-acetyltransferase I Not tested AbaR4e Protein 3e-32 54
aacC1/aacCA1 ACN81020.1 aminoglycoside-(3)-acetyltransferase AacC-A1 or AacC1 or AAC-(3)-Ia Not tested AbaR5 Protein 3e-32 54
aacCA1 AGK36643.1 aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR26 Protein 2e-32 53
aacC1/aacCA1 ACN81021.1 aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR5 Protein 3e-32 53
aacC1/aacCA1 ACV89836.1 type A aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR7 Protein 2e-32 53
aacC1 AFV53117.1 aminoglycoside (3) acetyltransferase AacC1 or AacC-A1 or AAC(3)-Ia Not tested AbGRI2-1 Protein 2e-32 53
aacCA5 AAR21853.1 aminoglycoside (3) acetyltransferase; AacCA5 or AAC(3)-Ie Not tested SGI1 Protein 4e-30 46
aacCA5 AGF35061.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 4e-30 46
aacCA5 AGK06931.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 4e-30 46
aacCA5 AGK06968.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 4e-30 46
aacCA5 AGK07014.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 4e-30 46
aacCA5 AGK07072.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 4e-30 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sala_0626 YP_615680.1 gentamicin 3'-N-acetyltransferase AF318077.1.gene3.p01 Protein 1e-32 54
Sala_0626 YP_615680.1 gentamicin 3'-N-acetyltransferase NC_011586.7045205.p0 Protein 8e-33 54
Sala_0626 YP_615680.1 gentamicin 3'-N-acetyltransferase NC_010410.6002585.p0 Protein 8e-33 54
Sala_0626 YP_615680.1 gentamicin 3'-N-acetyltransferase U04610.gene.p01 Protein 2e-32 53