Gene Information

Name : Sala_2435 (Sala_2435)
Accession : YP_617475.1
Strain : Sphingopyxis alaskensis RB2256
Genome accession: NC_008048
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2574002 - 2574409 bp
Length : 408 bp
Strand : -
Note : -

DNA sequence :
TTGCGTGACATGACCATCGGCCAGCTTGCCCGGCAGGGCGGCGTCAATGTCGAGACGATCCGCTATTACCAACGCCGCGG
CCTGTTGCCCGTTCCGCCTCAGTCGGCCAGCGCCCCGTCGGAAGGCCGAGTCCGGCGTTACGACGAGGCGGTTCTGCGCC
GTCTGCGCTTCATCAAATCGGCACAGGCAGCGGGATTTACGCTCACCGAGATCGCCGAACTGCTCGAACTCGACGCGTCG
AGCGATCGCGCGCGAGCGCGCGAACTGGCCGACGCGCGCATCGCGGCGATCGAAAAGACGATCGCCGAACTCGATGTGGC
GCGGCGCGCGCTCATGGGCCTGTCGCGCCAATGCGCTGCCGCCGACACGCTCCACTGCCCGATCATAGCGGCGTTCGAGC
AGATCTAG

Protein sequence :
MRDMTIGQLARQGGVNVETIRYYQRRGLLPVPPQSASAPSEGRVRRYDEAVLRRLRFIKSAQAAGFTLTEIAELLELDAS
SDRARARELADARIAAIEKTIAELDVARRALMGLSRQCAAADTLHCPIIAAFEQI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 7e-18 44
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 6e-15 43
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 9e-16 43
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-15 43
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-15 43
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-14 42
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-14 42
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-14 42
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-14 42
merR AGK07025.1 MerR Not tested SGI1 Protein 2e-14 42
merR AGK07083.1 MerR Not tested SGI1 Protein 2e-14 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sala_2435 YP_617475.1 MerR family transcriptional regulator BAC0689 Protein 1e-16 43
Sala_2435 YP_617475.1 MerR family transcriptional regulator BAC0687 Protein 7e-15 42
Sala_2435 YP_617475.1 MerR family transcriptional regulator BAC0684 Protein 9e-16 42
Sala_2435 YP_617475.1 MerR family transcriptional regulator BAC0686 Protein 6e-16 42
Sala_2435 YP_617475.1 MerR family transcriptional regulator BAC0232 Protein 7e-15 42
Sala_2435 YP_617475.1 MerR family transcriptional regulator BAC0683 Protein 9e-16 42
Sala_2435 YP_617475.1 MerR family transcriptional regulator BAC0688 Protein 8e-16 41