Gene Information

Name : PSEEN1974 (PSEEN1974)
Accession : YP_607614.1
Strain : Pseudomonas entomophila L48
Genome accession: NC_008027
Putative virulence/resistance : Unknown
Product : transposase, OrfA
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 2055996 - 2056304 bp
Length : 309 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type e : enzyme

DNA sequence :
ATGCAAGAGCGAAAGACCTATACCCGTGACTTCAAGCAACGTGCCGCAAGCATGGTTCTTGATGACAACAGCTCGGTTCC
CGACGTCTGTGCGTTATTGGACGTCGGCCCCACGGCTCTACGCCGCTGGGTTGATCAGGTTCGCAAAGAGCGTCAGAAAG
GGCAGCCAGTGGCAGGTACCAAGGCAATCAGCGACGAACAGCGAGAGCTTCAACAGCTGCGAGCCAAAGTCAAACGCCTG
GAGACCGAGGCCGAAATATTAAAAAAGGCTACGGCTCTCTTGATGTCGGATCCCGATCGTTTTTCCTGA

Protein sequence :
MQERKTYTRDFKQRAASMVLDDNSSVPDVCALLDVGPTALRRWVDQVRKERQKGQPVAGTKAISDEQRELQQLRAKVKRL
ETEAEILKKATALLMSDPDRFS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 3e-16 51
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-15 46
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-15 46
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-14 46
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-14 46
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-14 46
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-14 46
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-14 46
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-14 46
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-14 46
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-14 46
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-14 46
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-14 43
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSEEN1974 YP_607614.1 transposase, OrfA VFG1485 Protein 6e-16 46
PSEEN1974 YP_607614.1 transposase, OrfA VFG1553 Protein 1e-14 46
PSEEN1974 YP_607614.1 transposase, OrfA VFG1123 Protein 6e-15 46