|
Name : PSEEN1974 (PSEEN1974) Accession : YP_607614.1 Strain : Pseudomonas entomophila L48 Genome accession: NC_008027 Putative virulence/resistance : Unknown Product : transposase, OrfA Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 2055996 - 2056304 bp Length : 309 bp Strand : + Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type e : enzyme DNA sequence : ATGCAAGAGCGAAAGACCTATACCCGTGACTTCAAGCAACGTGCCGCAAGCATGGTTCTTGATGACAACAGCTCGGTTCC CGACGTCTGTGCGTTATTGGACGTCGGCCCCACGGCTCTACGCCGCTGGGTTGATCAGGTTCGCAAAGAGCGTCAGAAAG GGCAGCCAGTGGCAGGTACCAAGGCAATCAGCGACGAACAGCGAGAGCTTCAACAGCTGCGAGCCAAAGTCAAACGCCTG GAGACCGAGGCCGAAATATTAAAAAAGGCTACGGCTCTCTTGATGTCGGATCCCGATCGTTTTTCCTGA Protein sequence : MQERKTYTRDFKQRAASMVLDDNSSVPDVCALLDVGPTALRRWVDQVRKERQKGQPVAGTKAISDEQRELQQLRAKVKRL ETEAEILKKATALLMSDPDRFS |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| RS05 | AAP82950.1 | putative transposase | Not tested | PAPI-2 | Protein | 3e-16 | 51 |
| l7045 | CAD33744.1 | - | Not tested | PAI I 536 | Protein | 1e-15 | 46 |
| orfA | CAE85179.1 | OrfA protein, IS911 | Not tested | PAI V 536 | Protein | 1e-15 | 46 |
| unnamed | CAD42034.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 3e-14 | 46 |
| orfA | ACX47959.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-14 | 46 |
| VPI2_0009c | ACA01826.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 1e-14 | 46 |
| orfA | AGK06911.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-14 | 46 |
| unnamed | AGK06948.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-14 | 46 |
| VC1790 | NP_231425.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 2e-14 | 46 |
| orfA | AGK06994.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-14 | 46 |
| orfA | YP_001217330.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 2e-14 | 46 |
| orfA | AGK07052.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-14 | 46 |
| insN | YP_002152325.1 | transposase for insertion sequence element IS911 | Not tested | Not named | Protein | 1e-14 | 43 |
| api80 | CAF28554.1 | putative transposase | Not tested | YAPI | Protein | 2e-12 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| PSEEN1974 | YP_607614.1 | transposase, OrfA | VFG1485 | Protein | 6e-16 | 46 |
| PSEEN1974 | YP_607614.1 | transposase, OrfA | VFG1553 | Protein | 1e-14 | 46 |
| PSEEN1974 | YP_607614.1 | transposase, OrfA | VFG1123 | Protein | 6e-15 | 46 |
