Gene Information

Name : Dgeo_0087 (Dgeo_0087)
Accession : YP_603559.1
Strain : Deinococcus geothermalis DSM 11300
Genome accession: NC_008025
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 81377 - 82045 bp
Length : 669 bp
Strand : +
Note : PFAM: response regulator receiver: (1.1e-35) transcriptional regulatory protein-like: (4.8e-26); KEGG: ttj:TTHA1722 response regulator, ev=2e-75, 65% identity

DNA sequence : 
ATGGCCCGCATCCTGATTGTCGACGACGACCCCGCCATCCTGGAGATTCTGGGCGCCTACCTGCGCGCCGAGGGACACGT
CGTGCTGGAGACGCAAGACGGGACCACCGGACGGGCCAAGCTGGCGGAAGCTGACCTCGCCATCCTCGACTGGATGTTGC
CGGGGGCCAGCGGCCTGGACTTGGCGCGCCAGCAGCGCCGCGACCGTCCGGACTTCCCGATCCTGCTGCTGACCGCGCGA
GGTGAGGAGGAGGACAAACTGCGTGGCCTGGAGGCCGGCGCCGACGACTACGTCACCAAGCCCTTCTCTCCTCGTGAGGT
CGTGGCGCGTGTGCGAGCGCTGTTGCGGCGGGCACGCCTGCAGGACAGCGTATCGACGGGTGGTCTGCAGCTGGACGAAC
GGACCCGCACCGCCATGCTCGACGGGCAGGAACTCCTCCTTTCGAAGCTGGAATTTGACCTGCTGCTCACTCTGGCGCGC
CATCCCGGCTTCGTGTGGTCGCGGGACCGTCTGCTCGAACGGGTCTGGGGCGCCGATTTTCCCGGTGTGGAGCGAGTGGT
GGACGTTCATATGGCGGCTCTGCGCCGCAAATTGGGAGAGCACCCGGAGCAGCCGCGCTTCATCGAGACCGTGCGCGGTG
TGGGATACCGTTTCCGGGAGGAGGCATGA

Protein sequence : 
MARILIVDDDPAILEILGAYLRAEGHVVLETQDGTTGRAKLAEADLAILDWMLPGASGLDLARQQRRDRPDFPILLLTAR
GEEEDKLRGLEAGADDYVTKPFSPREVVARVRALLRRARLQDSVSTGGLQLDERTRTAMLDGQELLLSKLEFDLLLTLAR
HPGFVWSRDRLLERVWGADFPGVERVVDVHMAALRRKLGEHPEQPRFIETVRGVGYRFREEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 4e-12 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dgeo_0087 YP_603559.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-26 46
Dgeo_0087 YP_603559.1 two component transcriptional regulator BAC0039 Protein 4e-23 44
Dgeo_0087 YP_603559.1 two component transcriptional regulator CP001138.1.gene2239. Protein 2e-23 44
Dgeo_0087 YP_603559.1 two component transcriptional regulator CP000034.1.gene2186. Protein 4e-23 44
Dgeo_0087 YP_603559.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-23 44
Dgeo_0087 YP_603559.1 two component transcriptional regulator BAC0596 Protein 2e-23 44
Dgeo_0087 YP_603559.1 two component transcriptional regulator CP001918.1.gene3444. Protein 5e-23 43
Dgeo_0087 YP_603559.1 two component transcriptional regulator CP004022.1.gene1676. Protein 6e-23 43
Dgeo_0087 YP_603559.1 two component transcriptional regulator BAC0197 Protein 2e-16 42
Dgeo_0087 YP_603559.1 two component transcriptional regulator CP000647.1.gene2531. Protein 3e-22 42
Dgeo_0087 YP_603559.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-16 41
Dgeo_0087 YP_603559.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-31 41
Dgeo_0087 YP_603559.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 8e-24 41
Dgeo_0087 YP_603559.1 two component transcriptional regulator HE999704.1.gene2815. Protein 5e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dgeo_0087 YP_603559.1 two component transcriptional regulator VFG1390 Protein 6e-21 43
Dgeo_0087 YP_603559.1 two component transcriptional regulator VFG1386 Protein 2e-20 41