Gene Information

Name : Dgeo_2318 (Dgeo_2318)
Accession : YP_605779.1
Strain : Deinococcus geothermalis DSM 11300
Genome accession: NC_008025
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2438439 - 2439116 bp
Length : 678 bp
Strand : -
Note : PFAM: response regulator receiver: (7.1e-36) transcriptional regulatory protein-like: (2.2e-27); KEGG: dra:DR0743 response regulator, ev=1e-122, 100% identity

DNA sequence :
ATGGAACGCAAGCCTCTGGTCCTCGTCATTGAGGATGAAAAAGATATTGCCCGCTTCATCGAACTGGAATTGGCTGCCGA
GGGCTATGCCACTGAGGTGGCCTTCGATGGCGTGACTGGCCTCAGCAAATTCCGTGAAGTGAACCCTGACCTGGTGATCC
TGGACCTGATGCTGCCGGTGCTGGACGGGTTGGAAGTGGCGCGGCGCATTCGCAAGACCAGCAACACGCCGATCATCATC
CTCACCGCCAAGGACGGCATCCAGGACAAGGTGGAGGGCCTGGATTCCGGCGCGGACGACTATCTGATCAAGCCGTTTTC
CATCGAGGAGCTGCTGGCCCGTGTCCGCGCCCACCTGCGCCGGGTGAACCCGGCCGTGACCGGGGAGGTGCGGGTGGCCG
ACCTGGTGATGAATCTGGATGGGCGCGAGATTTTCCGGGGTGGGCGCCGGGTGGAACTCAGTGCCAAGGAGTTCGAGCTG
CTCGAGTTGCTCGCGCGCAACCCCGGCAAGGTCTTTTCCCGCTTTGAGATCGAGGAGAAGGTCTGGCCGGAGTACACCGG
GGGCAGCAACGTGGTGGACGTGTATATCGGCTACCTGCGCCGCAAGCTGGAGGAGGGCGGGGAGCGCCGCCTGATCCACA
CGGTGCGCGGCGTGGGCTACGTGCTGCGTGAGGAGTAG

Protein sequence :
MERKPLVLVIEDEKDIARFIELELAAEGYATEVAFDGVTGLSKFREVNPDLVILDLMLPVLDGLEVARRIRKTSNTPIII
LTAKDGIQDKVEGLDSGADDYLIKPFSIEELLARVRAHLRRVNPAVTGEVRVADLVMNLDGREIFRGGRRVELSAKEFEL
LELLARNPGKVFSRFEIEEKVWPEYTGGSNVVDVYIGYLRRKLEEGGERRLIHTVRGVGYVLREE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-28 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-27 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dgeo_2318 YP_605779.1 two component transcriptional regulator HE999704.1.gene1528. Protein 7e-33 48
Dgeo_2318 YP_605779.1 two component transcriptional regulator BAC0125 Protein 9e-35 46
Dgeo_2318 YP_605779.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-33 45
Dgeo_2318 YP_605779.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-33 45
Dgeo_2318 YP_605779.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-33 45
Dgeo_2318 YP_605779.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-33 45
Dgeo_2318 YP_605779.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-33 45
Dgeo_2318 YP_605779.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-33 45
Dgeo_2318 YP_605779.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-33 45
Dgeo_2318 YP_605779.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-28 45
Dgeo_2318 YP_605779.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-33 45
Dgeo_2318 YP_605779.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-27 45
Dgeo_2318 YP_605779.1 two component transcriptional regulator BAC0197 Protein 7e-30 45
Dgeo_2318 YP_605779.1 two component transcriptional regulator BAC0083 Protein 5e-31 43
Dgeo_2318 YP_605779.1 two component transcriptional regulator BAC0308 Protein 4e-32 43
Dgeo_2318 YP_605779.1 two component transcriptional regulator BAC0638 Protein 1e-22 43
Dgeo_2318 YP_605779.1 two component transcriptional regulator BAC0347 Protein 4e-26 41
Dgeo_2318 YP_605779.1 two component transcriptional regulator BAC0111 Protein 4e-29 41
Dgeo_2318 YP_605779.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-25 41
Dgeo_2318 YP_605779.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dgeo_2318 YP_605779.1 two component transcriptional regulator VFG1390 Protein 6e-37 50
Dgeo_2318 YP_605779.1 two component transcriptional regulator VFG1389 Protein 5e-26 45
Dgeo_2318 YP_605779.1 two component transcriptional regulator VFG0596 Protein 3e-28 43
Dgeo_2318 YP_605779.1 two component transcriptional regulator VFG1386 Protein 1e-28 42