
|
Name : Dgeo_0130 (Dgeo_0130) Accession : YP_603602.1 Strain : Deinococcus geothermalis DSM 11300 Genome accession: NC_008025 Putative virulence/resistance : Virulence Product : two component transcriptional regulator Function : - COG functional category : T : Signal transduction mechanisms COG ID : COG0745 EC number : - Position : 119442 - 120131 bp Length : 690 bp Strand : - Note : PFAM: response regulator receiver: (6.9e-31) transcriptional regulatory protein-like: (2.7e-25); KEGG: dra:DR2245 phosphate regulon transcriptional regulatory protein PhoB, ev=1e-104, 83% identity DNA sequence : ATGAGCCACGTGGTCGTCATCGAGGACGAGAGCACCGTGCGGGAGGTGCTGCGCTTTCATCTGGAGCGGGCCGGGCTGCG GGTGAGCGCGCTGGAATCGGTGCAGGGCGCCCAGGAGACGCTGCGGGGCGCCGACGCGCTGGTGCTGGACTGGATGCTGC CGGGCGAGAGCGGCCTCGCGTATCTGCGCCGGCTGCGCGGGGATCCGGAGCTGCGCCGCCTGCCCGTGCTGATGCTTACT GCTCGCGCGGCGGAGGCCGAGCGCGTGGAGGGCCTCGAAAGCGGCGCCGACGACTACCTCACCAAGCCCTTCAGCGCGGC GGAACTGGTCGCCCGCGTGCGGGCCTTGCTGCGCCGTGCCCAGCCTGACACGCCGCAACAGCTCAGCCACGGTCCCCTCA GCATGGACCTGGGCGCGGCCGAGGCGCGGCTGGCTGGCATTCGGCTGCACCTCACTCGGCGCGAATTCGACCTGCTGGCC TTTCTGACCCAGAACGCCGGGCGGGTGTACACGCGCACCGAACTGCTCGACCGAGTGTGGGGCGCGGATTTCCTGGGCGG CGAGCGCACCGTGGACCAGCATGTCACGCAACTGCGCGCGCATCTGGGAGACGATCCAGCTCGGCCCCGCTTTCTGGAAA CGGTGCGCGGCAAGGGATACCGAATGCGGCCCTGGGAGGGGGAGAACTGA Protein sequence : MSHVVVIEDESTVREVLRFHLERAGLRVSALESVQGAQETLRGADALVLDWMLPGESGLAYLRRLRGDPELRRLPVLMLT ARAAEAERVEGLESGADDYLTKPFSAAELVARVRALLRRAQPDTPQQLSHGPLSMDLGAAEARLAGIRLHLTRREFDLLA FLTQNAGRVYTRTELLDRVWGADFLGGERTVDQHVTQLRAHLGDDPARPRFLETVRGKGYRMRPWEGEN |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| copR | NP_460069.2 | transcriptional regulatory protein YedW | Not tested | SPI-5 | Protein | 7e-19 | 45 |
| copR | AAC33719.1 | regulatory protein CopR | Not tested | SPI-5 | Protein | 9e-18 | 43 |
| armR | AAN62112.1 | putative response-regulator ArmR | Not tested | PAGI-2(C) | Protein | 7e-17 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | CP001918.1.gene5135. | Protein | 4e-17 | 42 |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | NC_002952.2859905.p0 | Protein | 4e-30 | 41 |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | NC_009641.5332272.p0 | Protein | 3e-30 | 41 |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | NC_013450.8614421.p0 | Protein | 3e-30 | 41 |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | NC_007793.3914279.p0 | Protein | 3e-30 | 41 |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | NC_007622.3794472.p0 | Protein | 4e-30 | 41 |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | NC_002745.1124361.p0 | Protein | 3e-30 | 41 |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | NC_009782.5559369.p0 | Protein | 3e-30 | 41 |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | NC_002951.3237708.p0 | Protein | 3e-30 | 41 |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | NC_003923.1003749.p0 | Protein | 3e-30 | 41 |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | NC_002758.1121668.p0 | Protein | 3e-30 | 41 |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | NC_012469.1.7685629. | Protein | 2e-30 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | VFG0596 | Protein | 3e-19 | 45 |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | VFG1389 | Protein | 8e-25 | 43 |
| Dgeo_0130 | YP_603602.1 | two component transcriptional regulator | VFG1390 | Protein | 5e-25 | 42 |