Gene Information

Name : Dgeo_0130 (Dgeo_0130)
Accession : YP_603602.1
Strain : Deinococcus geothermalis DSM 11300
Genome accession: NC_008025
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 119442 - 120131 bp
Length : 690 bp
Strand : -
Note : PFAM: response regulator receiver: (6.9e-31) transcriptional regulatory protein-like: (2.7e-25); KEGG: dra:DR2245 phosphate regulon transcriptional regulatory protein PhoB, ev=1e-104, 83% identity

DNA sequence : 
ATGAGCCACGTGGTCGTCATCGAGGACGAGAGCACCGTGCGGGAGGTGCTGCGCTTTCATCTGGAGCGGGCCGGGCTGCG
GGTGAGCGCGCTGGAATCGGTGCAGGGCGCCCAGGAGACGCTGCGGGGCGCCGACGCGCTGGTGCTGGACTGGATGCTGC
CGGGCGAGAGCGGCCTCGCGTATCTGCGCCGGCTGCGCGGGGATCCGGAGCTGCGCCGCCTGCCCGTGCTGATGCTTACT
GCTCGCGCGGCGGAGGCCGAGCGCGTGGAGGGCCTCGAAAGCGGCGCCGACGACTACCTCACCAAGCCCTTCAGCGCGGC
GGAACTGGTCGCCCGCGTGCGGGCCTTGCTGCGCCGTGCCCAGCCTGACACGCCGCAACAGCTCAGCCACGGTCCCCTCA
GCATGGACCTGGGCGCGGCCGAGGCGCGGCTGGCTGGCATTCGGCTGCACCTCACTCGGCGCGAATTCGACCTGCTGGCC
TTTCTGACCCAGAACGCCGGGCGGGTGTACACGCGCACCGAACTGCTCGACCGAGTGTGGGGCGCGGATTTCCTGGGCGG
CGAGCGCACCGTGGACCAGCATGTCACGCAACTGCGCGCGCATCTGGGAGACGATCCAGCTCGGCCCCGCTTTCTGGAAA
CGGTGCGCGGCAAGGGATACCGAATGCGGCCCTGGGAGGGGGAGAACTGA

Protein sequence : 
MSHVVVIEDESTVREVLRFHLERAGLRVSALESVQGAQETLRGADALVLDWMLPGESGLAYLRRLRGDPELRRLPVLMLT
ARAAEAERVEGLESGADDYLTKPFSAAELVARVRALLRRAQPDTPQQLSHGPLSMDLGAAEARLAGIRLHLTRREFDLLA
FLTQNAGRVYTRTELLDRVWGADFLGGERTVDQHVTQLRAHLGDDPARPRFLETVRGKGYRMRPWEGEN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-19 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-18 43
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 7e-17 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dgeo_0130 YP_603602.1 two component transcriptional regulator CP001918.1.gene5135. Protein 4e-17 42
Dgeo_0130 YP_603602.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-30 41
Dgeo_0130 YP_603602.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-30 41
Dgeo_0130 YP_603602.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-30 41
Dgeo_0130 YP_603602.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-30 41
Dgeo_0130 YP_603602.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-30 41
Dgeo_0130 YP_603602.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-30 41
Dgeo_0130 YP_603602.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-30 41
Dgeo_0130 YP_603602.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-30 41
Dgeo_0130 YP_603602.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-30 41
Dgeo_0130 YP_603602.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-30 41
Dgeo_0130 YP_603602.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dgeo_0130 YP_603602.1 two component transcriptional regulator VFG0596 Protein 3e-19 45
Dgeo_0130 YP_603602.1 two component transcriptional regulator VFG1389 Protein 8e-25 43
Dgeo_0130 YP_603602.1 two component transcriptional regulator VFG1390 Protein 5e-25 42